HLA-DQA2 (NM_020056) Human Tagged ORF Clone

SKU
RC223979
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HLA-DQA2
Synonyms DC-alpha; DX-ALPHA; HLA-DCA; HLA-DXA; HLADQA2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223979 representing NM_020056
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCTAAACAAAGCTCTGCTGCTGGGGGCCCTCGCCCTGACTGCCGTGATGAGCCCCTGTGGAGGTG
AAGACATTGTGGCTGACCATGTTGCCTCCTATGGTGTGAACTTCTACCAGTCTCACGGTCCCTCTGGCCA
GTACACCCATGAATTTGATGGAGACGAGGAGTTCTACGTGGACCTGGAGACGAAAGAGACTGTCTGGCAG
TTGCCTATGTTTAGCAAATTTATAAGTTTTGACCCGCAGAGTGCACTGAGAAATATGGCTGTGGGAAAAC
ACACCTTGGAATTCATGATGAGACAGTCCAACTCTACCGCTGCCACCAATGAGGTTCCTGAGGTCACAGT
GTTTTCCAAGTTTCCTGTGACGCTGGGTCAGCCCAACACCCTCATCTGTCTTGTGGACAACATCTTTCCT
CCTGTGGTCAACATCACCTGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACCAGCTTCC
TCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTA
TGACTGCAAGGTGGAGCACTGGGGCCTGGACGAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCC
CCTATGTCAGAGCTCACAGAGACTTTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCATGGGCATTGTGG
TGGGCACTGTCTTCATCATCCAAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCTCTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223979 representing NM_020056
Red=Cloning site Green=Tags(s)

MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQ
LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFP
PVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPA
PMSELTETLVCALGLSVGLMGIVVGTVFIIQGLRSVGASRHQGLL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020056
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020056.2, NP_064440.1
RefSeq Size 1709 bp
RefSeq ORF 768 bp
Locus ID 3118
UniProt ID P01906
Cytogenetics 6p21.32
Domains ig, IGc1, MHC_II_alpha
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis
MW 27.9 kDa
Summary This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognized by CD4 T-cells. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:HLA-DQA2 (NM_020056) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223979L1 Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), Myc-DDK-tagged 10 ug
$600.00
RC223979L2 Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), mGFP tagged 10 ug
$600.00
RC223979L3 Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), Myc-DDK-tagged 10 ug
$600.00
RC223979L4 Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), mGFP tagged 10 ug
$600.00
RG223979 HLA (tGFP-tagged) - Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC315936 HLA (untagged)-Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.