AKAP7 (NM_138633) Human Tagged ORF Clone

SKU
RC223812
AKAP7 (Myc-DDK-tagged)-Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AKAP7
Synonyms AKAP15; AKAP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223812 representing NM_138633
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCAGCTTTGCTGCTTTCCTTTCTCAAGAGATGAAGGAAAAATCAGTGAGTTGGAAAGCTCGTCCT
CTGCAGTCCTACAGAGATACAGCAAGGATATACCCAGTTGGTCAAGTGGTGAAAAGAACGGAGGGGAGCC
CGATGACGCTGAACTAGTAAGGCTCAGTAAGAGGCTGGTGGAGAACGCGGTGCTCAAGGCTGTCCAGCAG
TATCTGGAGGAAACACAGAATAAAAACAAGCCGGGGGAGGGGAGCTCTGTGAAAACCGAAGCAGCTGATC
AGAATGGCAATGACAATGAGAACAACAGGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223812 representing NM_138633
Red=Cloning site Green=Tags(s)

MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ
YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138633
ORF Size 312 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138633.3
RefSeq Size 2348 bp
RefSeq ORF 315 bp
Locus ID 9465
UniProt ID O43687
Cytogenetics 6q23.2
Protein Families Druggable Genome
MW 11.3 kDa
Summary This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011]
Write Your Own Review
You're reviewing:AKAP7 (NM_138633) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223812L3 Lenti-ORF clone of AKAP7 (Myc-DDK-tagged)-Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta 10 ug
$465.00
RC223812L4 Lenti-ORF clone of AKAP7 (mGFP-tagged)-Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta 10 ug
$465.00
RG223812 AKAP7 (tGFP-tagged) - Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta 10 ug
$489.00
SC110061 AKAP7 (untagged)-Human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.