BMF (NM_033503) Human Tagged ORF Clone

SKU
RC223634
BMF (Myc-DDK-tagged)-Human Bcl2 modifying factor (BMF), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BMF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223634 representing NM_033503
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCATCTCAGTGTGTGGAGGAGCTGGAGGATGATGTGTTCCAACCAGAGGATGGGGAGCCGGTGA
CCCAACCCGGGAGCTTGCTCTCTGCTGACCTGTTTGCCCAGAGCCTACTGGACTGCCCCCTCAGCCGACT
TCAGCTCTTCCCTCTCACCCACTGCTGTGGCCCTGGCCTTCGACCCACCAGCCAGGAAGACAAAGCTACC
CAGACTCTCAGCCCAGCCTCCCCCAGCCCAGGTGTCATGCTGCCTTGTGGGGTGACTGAGGAACCCCAGC
GACTCTTTTATGGCAATGCTGGCTATCGGCTTCCTCTCCCTGCCAGTTTCCCAGCAGTCTTGCCCATTGG
GGAGCAGCCCCCCGAAGGGCAGTGGCAACATCAAGCAGAGGTACAGATTGCCCGAAAGCTTCAGTGCATT
GCAGACCAGTTCCACCGGCTTCATGTGCAGCAACACCAGCAGAACCAAAATCGTGTGTGGTGGCAGATCC
TCCTCTTCCTGCACAACCTTGCTTTGAATGGAGAAGAGAACAGGAACGGGGCAGGCCCTAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223634 representing NM_033503
Red=Cloning site Green=Tags(s)

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
QTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCI
ADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033503
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033503.4
RefSeq Size 4551 bp
RefSeq ORF 555 bp
Locus ID 90427
UniProt ID Q96LC9
Cytogenetics 15q15.1
Protein Families Druggable Genome
MW 20.3 kDa
Summary The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:BMF (NM_033503) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223634L3 Lenti ORF clone of Human Bcl2 modifying factor (BMF), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC223634L4 Lenti ORF clone of Human Bcl2 modifying factor (BMF), transcript variant 2, mGFP tagged 10 ug
$600.00
RG223634 BMF (tGFP-tagged) - Human Bcl2 modifying factor (BMF), transcript variant 2 10 ug
$500.00
SC316321 BMF (untagged)-Human Bcl2 modifying factor (BMF), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.