UBE2J2 (NM_058167) Human Tagged ORF Clone

SKU
RC223522
UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2J2
Synonyms NCUBE-2; NCUBE2; PRO2121
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223522 representing NM_058167
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGCACCAGCAGTAAGAGGGCTCCGACCACGGCAACCCAGAGGCTGAAGCAGGACTACCTTCGCA
TTAAGAAAGACCCGGTGCCTTACATCTGTGCCGAGCCCCTCCCTTCGAATATTCTCGAGTGGCACTATGT
CGTCCGAGGCCCAGAGATGACCCCTTATGAAGGTGGCTATTATCATGGAAAACTAATTTTTCCCAGAGAA
TTTCCTTTCAAACCTCCCAGTATCTATATGATCACTCCCAACGGGAGGTTTAAGTGCAACACCAGGCTGT
GTCTTTCTATCACGGATTTCCACCCGGACACGTGGAACCCGGCCTGGTCTGTCTCCACCATCCTGACTGG
GCTCCTGAGCTTCATGGTGGAGAAGGGCCCCACCCTGGGCAGTATAGAGACGTCGGACTTCACGAAAAGA
CAACTGGCAGTGCAGAGTTTAGCATTTAATTTGAAAGATAAAGTCTTTTGTGAATTATTTCCTGAAGTCG
TGGAGGAGATTAAACAAAAACAGAAAGCACAAGACGAACTCAGTAGCAGACCCCAGACTCTCCCCTTGCC
AGACGTGGTTCCAGACGGGGAGACGCACCTCGTCCAGAACGGGATTCAGCTGCTCAACGGGCATGCGCCG
GGGGCCGTCCCAAACCTCGCAGGGCTCCAGCAGGCCAACCGGCACCACGGACTCCTGGGTGGCGCCCTGG
CGAACTTGTTTGTGATAGTTGGGTTTGCAGCCTTTGCTTACACGGTCAAGTACGTGCTGAGGAGCATCGC
GCAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223522 representing NM_058167
Red=Cloning site Green=Tags(s)

MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPRE
FPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKR
QLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAP
GAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_058167
ORF Size 777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_058167.3
RefSeq Size 2267 bp
RefSeq ORF 780 bp
Locus ID 118424
UniProt ID Q8N2K1
Cytogenetics 1p36.33
Domains UBCc
Protein Families Transmembrane
Protein Pathways Parkinson's disease, Ubiquitin mediated proteolysis
MW 28.7 kDa
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:UBE2J2 (NM_058167) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223522L3 Lenti-ORF clone of UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2 10 ug
$630.00
RC223522L4 Lenti-ORF clone of UBE2J2 (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2 10 ug
$630.00
RG223522 UBE2J2 (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2 10 ug
$530.00
SC310589 UBE2J2 (untagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.