DAP3 (NM_033657) Human Tagged ORF Clone

SKU
RC223182
DAP3 (Myc-DDK-tagged)-Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DAP3
Synonyms bMRP-10; DAP-3; MRP-S29; MRPS29; S29mt
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223182 representing NM_033657
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCTGAAAGGAATAACAAGGCTTATCTCTAGGATCCATAAGTTGGACCCTGGGCGTTTTTTACACA
TGGGGACCCAGGCTCGCCAAAGCATTGCTGCTCACCTAGATAACCAGGTTCCAGTTGAGAGTCCGAGAGC
TATTTCCCGCACCAATGAGAATGACCCGGCCAAGCATGGGGATCAGCACGAGGGTCAGCACTACAACATC
TCCCCCCAGGATTTGGAGACTGTATTTCCCCATGGCCTTCCTCCTCGCTTTGTGATGCAGGTGAAGACAT
TCAGTGAAGCTTGCCTGATGGTAAGGAAACCAGCCCTAGAACTTCTGCATTACCTGAAAAACACCAGTTT
TGCTTATCCAGCTATACGATATCTTCTGTATGGAGAGAAGGGAACAGGAAAAACCCTAAGTCTTTGCCAT
GTTATTCATTTCTGTGCAAAACAGGACTGGCTGATACTACATATTCCAGATGCTCATCTTTGGGTGAAAA
ATTGTCGGGATCTTCTGCAGTCCAGCTACAACAAACAGCGCTTTGATCAACCTTTAGAGGCTTCAACCTG
GCTGAAGAATTTCAAAACTACAAATGAGCGCTTCCTGAACCAGATAAAAGTTCAAGAGAAGTATGTCTGG
AATAAGAGAGAAAGCACTGAGAAAGGGAGTCCTCTGGGAGAAGTGGTTGAACAGGGCATAACACGGGTGA
GGAACGCCACAGATGCAGTTGGAATTGTGCTGAAAGAGCTAAAGAGGCAAAGTTCTTTGGGTATGTTTCA
CCTCCTAGTGGCCGTGGATGGAATCAATGCTCTTTGGGGAAGAACCACTCTGAAAAGAGAAGATAAAAGC
CCGATTGCCCCCGAGGAATTAGCACTTGTTCACAACTTGAGGAAAATGATGAAAAATGATTGGCATGGAG
GCGCCATTGTGTCGGCTTTGAGCCAGACTGGGTCTCTCTTTAAGCCCCGGAAAGCCTATCTGCCCCAGGA
GTTGCTGGGAAAGGAAGGATTTGATGCCCTGGATCCCTTTATTCCCATCCTGGTTTCCAACTATAACCCA
AAGGAATTTGAAAGTTGTATTCAGTATTATTTGGAAAACAATTGGCTTCAACATGAGAAAGCTCCTACAG
AAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTA
CCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223182 representing NM_033657
Red=Cloning site Green=Tags(s)

MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNI
SPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCH
VIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVW
NKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKS
PIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP
KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033657
ORF Size 1194 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033657.2
RefSeq Size 1650 bp
RefSeq ORF 1197 bp
Locus ID 7818
UniProt ID P51398
Cytogenetics 1q22
Protein Families Druggable Genome
MW 45.4 kDa
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:DAP3 (NM_033657) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223182L1 Lenti ORF clone of Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC223182L2 Lenti ORF clone of Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged 10 ug
$757.00
RC223182L3 Lenti ORF clone of Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC223182L4 Lenti ORF clone of Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged 10 ug
$757.00
RG223182 DAP3 (tGFP-tagged) - Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC313298 DAP3 (untagged)-Human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.