STARD4 (NM_139164) Human Tagged ORF Clone

SKU
RC223123
STARD4 (Myc-DDK-tagged)-Human StAR-related lipid transfer (START) domain containing 4 (STARD4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol STARD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223123 representing NM_139164
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGCCTGTCTGATGTTGCTTCTTTTGCAACTAAACTTAAAAACACTCTCATCCAGTACCATAGCA
TTGAAGAAGATAAGTGGCGAGTTGCTAAGAAAACGAAAGATGTAACTGTTTGGAGAAAACCCTCAGAAGA
ATTTAATGGATATCTCTACAAAGCCCAAGGTGTTATAGATGACCTTGTCTATAGTATAATAGACCATATA
CGCCCAGGGCCTTGTCGTTTGGATTGGGACAGCTTGATGACTTCTTTGGATATTCTGGAGAACTTTGAAG
AGAATTGCTGTGTGATGCGTTACACTACTGCTGGTCAGCTTTGGAATATAATTTCCCCAAGAGAATTTGT
TGATTTCTCCTATACTGTGGGCTATAAAGAAGGGCTTTTATCTTGTGGAATAAGTCTTGACTGGGATGAA
AAGAGACCAGAATTTGTTCGAGGATATAACCATCCCTGTGGTTGGTTTTGTGTTCCACTTAAAGACAACC
CAAACCAGAGTCTTTTGACAGGATATATTCAGACAGATCTGCGTGGGATGATTCCTCAGTCTGCGGTAGA
TACAGCCATGGCAAGCACTTTAACCAACTTCTATGGTGATTTACGAAAAGCTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223123 representing NM_139164
Red=Cloning site Green=Tags(s)

MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHI
RPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDE
KRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_139164
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_139164.3
RefSeq Size 2264 bp
RefSeq ORF 618 bp
Locus ID 134429
UniProt ID Q96DR4
Cytogenetics 5q22.1
MW 23.3 kDa
Summary Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:STARD4 (NM_139164) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223123L1 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 4 (STARD4), Myc-DDK-tagged 10 ug
$600.00
RC223123L2 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 4 (STARD4), mGFP tagged 10 ug
$600.00
RC223123L3 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 4 (STARD4), Myc-DDK-tagged 10 ug
$600.00
RC223123L4 Lenti ORF clone of Human StAR-related lipid transfer (START) domain containing 4 (STARD4), mGFP tagged 10 ug
$600.00
RG223123 STARD4 (tGFP-tagged) - Human StAR-related lipid transfer (START) domain containing 4 (STARD4) 10 ug
$500.00
SC120593 STARD4 (untagged)-Human StAR-related lipid transfer (START) domain containing 4 (STARD4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.