AKR1D1 (NM_005989) Human Tagged ORF Clone

SKU
RC223056
AKR1D1 (Myc-DDK-tagged)-Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AKR1D1
Synonyms 3o5bred; CBAS2; SRD5B1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223056 representing NM_005989
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCTCAGTGCTGCAAGTCACCGCATACCTCTAAGTGATGGAAACAGCATTCCCATCATCGGACTTG
GTACCTACTCAGAACCTAAATCGACCCCTAAGGGAGCCTGTGCAACATCGGTGAAGGTTGCTATTGACAC
AGGGTACCGACATATTGATGGGGCCTACATCTACCAAAATGAACACGAAGTTGGGGAGGCCATCAGGGAG
AAGATAGCAGAAGGAAAGGTGCGGAGGGAAGATATCTTCTACTGTGGAAAGCTATGGGCTACAAATCATG
TCCCAGAGATGGTCCGCCCAACCCTGGAGAGGACACTCAGGGTCCTCCAGCTAGATTATGTGGATCTTTA
CATCATTGAAGTACCCATGGCCTTTAAGCCAGGAGATGAAATATACCCTAGAGATGAGAATGGCAAATGG
TTATATCACAAGTCAAATCTGTGTGCCACTTGGGAGGCGATGGAAGCTTGCAAAGACGCTGGCTTGGTGA
AATCCCTGGGAGTGTCCAATTTTAACCGCAGGCAGCTGGAGCTCATCCTGAACAAGCCAGGACTCAAACA
CAAGCCAGTCAGCAACCAGGTTGAGTGCCATCCGTATTTCACCCAGCCAAAACTCTTGAAATTTTGCCAA
CAACATGACATTGTCATTACTGCATATAGCCCTTTGGGGACCAGTAGGAATCCAATCTGGGTGAATGTTT
CTTCTCCACCTTTGTTAAAGGATGCACTTCTAAACTCATTGGGGAAAAGGTACAATAAGACAGCAGCTCA
AATTGTTTTGCGTTTCAACATCCAGCGAGGGGTGGTTGTCATTCCTAAAAGCTTTAATCTTGAAAGGATC
AAAGAAAATTTTCAGATCTTTGACTTTTCTCTCACTGAAGAAGAAATGAAGGACATTGAAGCCTTGAATA
AAAATGTCCGCTTTGTAGAATTGCTCATGTGGCGCGATCATCCTGAATACCCATTTCATGATGAATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223056 representing NM_005989
Red=Cloning site Green=Tags(s)

MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIRE
KIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKW
LYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQ
QHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERI
KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005989
ORF Size 978 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005989.4
RefSeq Size 2692 bp
RefSeq ORF 981 bp
Locus ID 6718
UniProt ID P51857
Cytogenetics 7q33
Domains aldo_ket_red
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Primary bile acid biosynthesis
MW 37.2 kDa
Summary The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. [provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:AKR1D1 (NM_005989) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223056L1 Lenti ORF clone of Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC223056L2 Lenti ORF clone of Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC223056L3 Lenti ORF clone of Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC223056L4 Lenti ORF clone of Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG223056 AKR1D1 (tGFP-tagged) - Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116410 AKR1D1 (untagged)-Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.