Myelin oligodendrocyte glycoprotein (MOG) (NM_001008228) Human Tagged ORF Clone

SKU
RC222910
MOG (Myc-DDK-tagged)-Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$330.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Myelin oligodendrocyte glycoprotein
Synonyms BTN6; BTNL11; MOGIG2; NRCLP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222910 representing NM_001008228
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAGCTTATCAAGACCCTCTCTGCCCAGCTGCCTCTGCTCCTTCCTCCTCCTCCTCCTCCTCCAAG
TGTCTTCCAGCTATGCAGGGCAGTTCAGAGTGATAGGACCAAGACACCCTATCCGGGCTCTGGTCGGGGA
TGAAGTGGAATTGCCATGTCGCATATCTCCTGGGAAGAACGCTACAGGCATGGAGGTGGGGTGGTACCGC
CCCCCCTTCTCTAGGGTGGTTCATCTCTACAGAAATGGCAAGGACCAAGATGGAGACCAGGCACCTGAAT
ATCGGGGCCGGACAGAGCTGCTGAAAGATGCTATTGGTGAGGGAAAGGTGACTCTCAGGATCCGGAATGT
AAGGTTCTCAGATGAAGGAGGTTTCACCTGCTTCTTCCGAGATCATTCTTACCAAGAGGAGGCAGCAATG
GAATTGAAAGTAGAAGATCCTTTCTACTGGGTGAGCCCTGGAGTGCTGGTTCTCCTCGCGGTGCTGCCTG
TGCTCCTCCTGCAGATCACTGTTGGCCTCATCTTCCTCTGCCTGCAGTACAGACTGAGAGGAAAACTTCG
AGCAGAGATAGAGAATCTCCACCGGACTTTTGAGTCCTTTGGTGTTCTAGGACCCCAGGTTAAGGAACCA
AAAAAGACAGGGCAATTCCTTGAAGAGCTACGAAATCCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222910 representing NM_001008228
Red=Cloning site Green=Tags(s)

MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR
PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM
ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFESFGVLGPQVKEP
KKTGQFLEELRNPF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001008228
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001008228.3
RefSeq Size 2101 bp
RefSeq ORF 675 bp
Locus ID 4340
UniProt ID Q16653
Cytogenetics 6p22.1
Protein Families Transmembrane
MW 25.4 kDa
Summary The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myelin oligodendrocyte glycoprotein (MOG) (NM_001008228) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222910L3 Lenti-ORF clone of MOG (Myc-DDK-tagged)-Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3 10 ug
$630.00
RC222910L4 Lenti-ORF clone of MOG (mGFP-tagged)-Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3 10 ug
$630.00
RG222910 MOG (tGFP-tagged) - Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3 10 ug
$530.00
SC301268 MOG (untagged)-Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.