CRYGD (NM_006891) Human Tagged ORF Clone

SKU
RC222889
CRYGD (Myc-DDK-tagged)-Human crystallin, gamma D (CRYGD)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CRYGD
Synonyms CACA; CCA3; CCP; cry-g-D; CRYG4; CTRCT4; PCC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222889 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAGATCACCCTCTACGAGGACCGGGGCTTCCAGGGCCGCCACTACGAATGCAGCAGCGACCACC
CCAACCTGCAGCCCTACTTGAGCCGCTGCAACTCGGCGCGCGTGGACAGCGGCTGCTGGATGCTCTATGA
GCAGCCCAACTACTCGGGCCTCCAGTACTTCCTGCGCCGCGGCGACTATGCCGACCACCAGCAGTGGATG
GGCCTCAGCGACTCGGTCCGCTCCTGCCGCCTCATCCCCCACTCTGGCTCTCACAGGATCAGACTCTATG
AGAGGGAGGACTACAGAGGCCAGATGATAGAGTTCACTGAGGACTGCTCCTGTCTTCAGGACCGCTTCCG
CTTCAATGAAATCCACTCCCTCAACGTGCTGGAGGGCTCCTGGGTCCTCTACGAGCTGTCCAACTACCGA
GGACGGCAGTACCTGCTGATGCCAGGGGACTATAGGCGCTACCAGGACTGGGGGGCCACGAATGCCAGAG
TGGGCTCTCTGAGGAGAGTCATAGATTTCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222889 protein sequence
Red=Cloning site Green=Tags(s)

MGKITLYEDRGFQGRHYECSSDHPNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWM
GLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYR
GRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006891
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006891.2, NP_008822.2
RefSeq Size 724 bp
RefSeq ORF 525 bp
Locus ID 1421
UniProt ID P07320
Cytogenetics 2q33.3
Protein Families Druggable Genome
MW 20.7 kDa
Summary Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CRYGD (NM_006891) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222889L1 Lenti ORF clone of Human crystallin, gamma D (CRYGD), Myc-DDK-tagged 10 ug
$600.00
RC222889L2 Lenti ORF clone of Human crystallin, gamma D (CRYGD), mGFP tagged 10 ug
$600.00
RC222889L3 Lenti ORF clone of Human crystallin, gamma D (CRYGD), Myc-DDK-tagged 10 ug
$600.00
RC222889L4 Lenti ORF clone of Human crystallin, gamma D (CRYGD), mGFP tagged 10 ug
$600.00
RG222889 CRYGD (tGFP-tagged) - Human crystallin, gamma D (CRYGD) 10 ug
$500.00
SC303845 CRYGD (untagged)-Human crystallin, gamma D (CRYGD) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.