UNG (NM_080911) Human Tagged ORF Clone

SKU
RC222868
UNG (Myc-DDK-tagged)-Human uracil-DNA glycosylase (UNG), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UNG
Synonyms DGU; HIGM4; HIGM5; UDG; UNG1; UNG2; UNG15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222868 representing NM_080911
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCGGCCAGAAGACGCTCTACTCCTTTTTCTCCCCCAGCCCCGCCAGGAAGCGACACGCCCCCAGCC
CCGAGCCGGCCGTCCAGGGGACCGGCGTGGCTGGGGTGCCTGAGGAAAGCGGAGATGCGGCGGCCATCCC
AGCCAAGAAGGCCCCGGCTGGGCAGGAGGAGCCTGGGACGCCGCCCTCCTCGCCGCTGAGTGCCGAGCAG
TTGGACCGGATCCAGAGGAACAAGGCCGCGGCCCTGCTCAGACTCGCGGCCCGCAACGTGCCCGTGGGCT
TTGGAGAGAGCTGGAAGAAGCACCTCAGCGGGGAGTTCGGGAAACCGTATTTTATCAAGCTAATGGGATT
TGTTGCAGAAGAAAGAAAGCATTACACTGTTTATCCACCCCCACACCAAGTCTTCACCTGGACCCAGATG
TGTGACATAAAAGATGTGAAGGTTGTCATCCTGGGACAGGATCCATATCATGGACCTAATCAAGCTCACG
GGCTCTGCTTTAGTGTTCAAAGGCCTGTTCCGCCTCCGCCCAGTTTGGAGAACATTTATAAAGAGTTGTC
TACAGACATAGAGGATTTTGTTCATCCTGGCCATGGAGATTTATCTGGGTGGGCCAAGCAAGGTGTTCTC
CTTCTCAACGCTGTCCTCACGGTTCGTGCCCATCAAGCCAACTCTCATAAGGAGCGAGGCTGGGAGCAGT
TCACTGATGCAGTTGTGTCCTGGCTAAATCAGAACTCGAATGGCCTTGTTTTCTTGCTCTGGGGCTCTTA
TGCTCAGAAGAAGGGCAGTGCCATTGATAGGAAGCGGCACCATGTACTACAGACGGCTCATCCCTCCCCT
TTGTCAGTGTATAGAGGGTTCTTTGGATGTAGACACTTTTCAAAGACCAATGAGCTGCTGCAGAAGTCTG
GCAAGAAGCCCATTGACTGGAAGGAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222868 representing NM_080911
Red=Cloning site Green=Tags(s)

MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ
LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM
CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL
LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP
LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080911
ORF Size 939 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080911.3
RefSeq Size 2053 bp
RefSeq ORF 942 bp
Locus ID 7374
UniProt ID P13051
Cytogenetics 12q24.11
Domains UDG
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Base excision repair, Primary immunodeficiency
MW 34.5 kDa
Summary This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:UNG (NM_080911) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222868L1 Lenti ORF clone of Human uracil-DNA glycosylase (UNG), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC222868L2 Lenti ORF clone of Human uracil-DNA glycosylase (UNG), transcript variant 2, mGFP tagged 10 ug
$750.00
RC222868L3 Lenti ORF clone of Human uracil-DNA glycosylase (UNG), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC222868L4 Lenti ORF clone of Human uracil-DNA glycosylase (UNG), transcript variant 2, mGFP tagged 10 ug
$750.00
RG222868 UNG (tGFP-tagged) - Human uracil-DNA glycosylase (UNG), transcript variant 2 10 ug
$650.00
SC109875 UNG (untagged)-Human uracil-DNA glycosylase (UNG), transcript variant 2 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.