WNT8B (NM_003393) Human Tagged ORF Clone

SKU
RC222670
WNT8B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 8B (WNT8B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WNT8B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222670 representing NM_003393
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCTTTCAAAGCCTTCTGTGTACATCTGTCTTTTCACCTGTGTCCTCCAACTCAGCCACAGCTGGT
CGGTGAACAATTTCCTGATGACTGGTCCAAAGGCTTACCTGATTTACTCCAGCAGTGTGGCAGCTGGTGC
CCAGAGTGGTATTGAAGAATGCAAGTATCAGTTTGCCTGGGACCGCTGGAACTGCCCTGAGAGAGCCCTG
CAGCTGTCCAGCCATGGTGGGCTTCGCAGTGCCAATCGGGAGACAGCATTTGTGCATGCCATCAGTTCTG
CTGGAGTCATGTACACCCTGACTAGAAACTGCAGCCTTGGAGATTTTGATAACTGTGGCTGTGATGACTC
CCGCAACGGGCAACTGGGGGGACAAGGCTGGCTGTGGGGAGGCTGCAGTGACAATGTGGGCTTCGGAGAG
GCGATTTCCAAGCAGTTTGTCGATGCCCTGGAAACAGGACAGGATGCACGGGCAGCCATGAACCTGCACA
ACAACGAGGCTGGCCGCAAGGCGGTGAAGGGCACCATGAAACGCACGTGCAAGTGCCACGGCGTGTCTGG
CAGCTGCACCACGCAGACCTGTTGGCTGCAGCTGCCCGAGTTCCGCGAGGTGGGCGCGCACCTGAAGGAG
AAGTACCACGCAGCACTCAAGGTGGACCTGCTGCAGGGTGCTGGCAACAGCGCGGCCGGCCGCGGCGCCA
TCGCCGACACCTTTCGCTCCATCTCTACCCGGGAGCTGGTGCACCTGGAGGACTCCCCGGACTACTGCCT
GGAGAACAAAACGCTAGGGCTGCTGGGCACCGAAGGCCGAGAGTGCCTAAGGCGCGGGCGGGCCCTGGGT
CGCTGGGAACGCCGCAGCTGCCGCCGGCTCTGCGGGGACTGCGGGCTGGCGGTGGAGGAGCGCCGGGCCG
AGACCGTGTCCAGCTGCAACTGCAAGTTCCACTGGTGCTGCGCAGTCCGCTGCGAGCAGTGCCGCCGGAG
GGTCACCAAGTACTTCTGTAGCCGCGCAGAGCGGCCGCGGGGGGGCGCTGCGCACAAACCCGGGAGAAAA
CCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222670 representing NM_003393
Red=Cloning site Green=Tags(s)

MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERAL
QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGE
AISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKE
KYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALG
RWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRK
P

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003393
ORF Size 1053 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003393.4
RefSeq Size 2117 bp
RefSeq ORF 1056 bp
Locus ID 7479
UniProt ID Q93098
Cytogenetics 10q24.31
Domains wnt
Protein Families Cancer stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway
MW 38.5 kDa
Summary The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:WNT8B (NM_003393) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222670L1 Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), Myc-DDK-tagged 10 ug
$757.00
RC222670L2 Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), mGFP tagged 10 ug
$757.00
RC222670L3 Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), Myc-DDK-tagged 10 ug
$757.00
RC222670L4 Lenti ORF clone of Human wingless-type MMTV integration site family, member 8B (WNT8B), mGFP tagged 10 ug
$757.00
RG222670 WNT8B (tGFP-tagged) - Human wingless-type MMTV integration site family, member 8B (WNT8B) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC118001 WNT8B (untagged)-Human wingless-type MMTV integration site family, member 8B (WNT8B) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.