TPSG1 (NM_012467) Human Tagged ORF Clone

SKU
RC222359
TPSG1 (Myc-DDK-tagged)-Human tryptase gamma 1 (TPSG1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TPSG1
Synonyms PRSS31; TMT; trpA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222359 representing NM_012467
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTTGGGGCCTGTGGCCTCCTGCTGCTCCTGGCTGTGCCCGGTGTGTCCCTCAGGACTTTGCAGC
CAGGGTGTGGCCGGCCGCAGGTTTCGGATGCAGGCGGCCGGATCGTGGGGGGTCACGCTGCCCCGGCCGG
CGCATGGCCATGGCAGGCCAGCCTCCGCCTGCGGAGGATGCACGTGTGCGGCGGGTCACTGCTCAGCCCC
CAGTGGGTGCTCACAGCTGCCCACTGCTTCTCCGGGTCCCTGAACTCATCCGACTACCAGGTGCACCTGG
GGGAACTGGAGATCACTTTGTCTCCCCACTTCTCCACCGTGAGGCAGATCATCCTGCACTCCAGCCCCTC
AGGACAGCCGGGGACCAGCGGGGACATCGCCCTGGTGGAGCTCAGTGTCCCCGTGACCCTCTCCAGCCGG
ATCCTGCCCGTCTGCCTCCCGGAGGCCTCAGATGACTTCTGCCCTGGGATCCGGTGCTCGGTGACCGGCT
GGGGCTATACGCGGGAGGGAGAGCCTCTGCCACCCCCGTACAGCCTGCGGGAGGTGAAAGTCTCCGTGGT
GGACACAGAGACCTGCCGCCGGGACTATCCCGGCCCCGGGGGCAGCATCCTTCAGCCCGACATGCTGTGT
GCCCGGGGCCCCGGGGATGCCTGCCAGGACGACTCCGGGGGGCCTCTGGTCTGCCAGGTGAACGGTGCCT
GGGTGCAGGCTGGCATTGTGAGCTGGGGTGAGGGCTGCGGCCGCCCCAACAGGCCGGGAGTCTACACTCG
TGTCCCTGCCTACGTGAACTGGATCCGCCGCCACATCACAGCATCAGGGGGCTCAGAGTCTGGGTACCCC
AGGCTCCCCCTCCTGGCTGGCTTCTTCCTCCCCGGCCTCTTCCTTCTGCTAGTCTCCTGTGTCCTGCTGG
CCAAGTGCCTGCTGCACCCATCTGCGGATGGTACTCCCTTCCCCGCCCCTGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222359 representing NM_012467
Red=Cloning site Green=Tags(s)

MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSP
QWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSR
ILPVCLPEASDDFCPGIRCSVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC
ARGPGDACQDDSGGPLVCQVNGAWVQAGIVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYP
RLPLLAGFFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012467
ORF Size 963 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012467.4
RefSeq Size 1124 bp
RefSeq ORF 966 bp
Locus ID 25823
UniProt ID Q9NRR2
Cytogenetics 16p13.3
Protein Families Druggable Genome, Transmembrane
MW 33.76 kDa
Summary Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. There is uncertainty regarding the number of genes in this cluster. Currently four functional genes - alpha I, beta I, beta II and gamma I - have been identified. And beta I has an allelic variant named alpha II, beta II has an allelic variant beta III, also gamma I has an allelic variant gamma II. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha-tryptases predominant. This gene differs from other members of the tryptase gene family in that it has C-terminal hydrophobic domain, which may serve as a membrane anchor. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TPSG1 (NM_012467) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222359L3 Lenti ORF clone of Human tryptase gamma 1 (TPSG1), Myc-DDK-tagged 10 ug
$600.00
RC222359L4 Lenti ORF clone of Human tryptase gamma 1 (TPSG1), mGFP tagged 10 ug
$600.00
RG222359 TPSG1 (tGFP-tagged) - Human tryptase gamma 1 (TPSG1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127922 TPSG1 (untagged)-Human tryptase gamma 1 (TPSG1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.