OR51F1 (NM_001004752) Human Tagged ORF Clone

SKU
RC222268
OR51F1 (Myc-DDK-tagged)-Human olfactory receptor, family 51, subfamily F, member 1 (OR51F1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OR51F1
Synonyms OR11-21; OR51F1P
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222268 representing NM_001004752
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAATCCTAAGCAACTCAACATCTAAATTTCCAACCTTCTTGTTGACCGGCATTCCTGGCCTAGAGT
CTGCCCATGTCTGGATCTCCATTCCTTTCTGTTGTTTTTATGCCATTGCCCTCTCTGGGAACAGCGTGAT
CCTGTTTGTCATCATTACCCAGCAGAGTCTCCATGAACCCATGTATTATTTCCTCTTCAGGCTATCAGCC
ACTGATCTGGGCTTGACTGTTTCTTCATTGTCAACAACATTAGGTATCCTCTGGTTTGAGGCACGTGAAA
TCAGTCTATATAGCTGCATTGTCCAGATGTTTTTTCTTCATGGATTCACTTTTATGGAATCTGGAGTGCT
GGTGGCTACAGCCTTTGACCGTTATGTGGCCATCTGTGACCCTCTGAGGTACACTACCATTCTCACTAAT
TCCAGAATCATTCAAATGGGTCTTCTGATGATTACACGTGCTATAGTACTAATATTGCCACTACTTTTGC
TCCTTAAGCCTCTCTATTTCTGTAGAATGAATGCCCTTTCTCACTCCTATTGTTACCATCCAGATGTGAT
TCAATTAGCATGTTCAGACATTCGGGCAAATAGCATCTGTGGATTAATTGATCTCATCCTGACCACTGGA
ATAGATACACCATGCATTGTCCTGTCATATATCTTAATTATTCACTCTGTCCTCAGAATTGCCTCCCCTG
AAGAATGGCACAAGGTCTTCAGCACCTGTGTCTCCCATGTGGGAGCAGTTGCTTTCTTCTACATCCACAT
GCTGAGCCTGTCCTTGGTGTATCGCTATGGTCGGTCAGCCCCCAGAGTAGTCCATTCAGTGATGGCTAAT
GTATACCTGCTTTTACCCCCTGTGCTCAACCCCATCATCGACAGTGTAAAAACAAAACAAATCCGCAAGG
CTATGCTCAGTCTGCTGCTTACAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222268 representing NM_001004752
Red=Cloning site Green=Tags(s)

MEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEPMYYFLFRLSA
TDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVATAFDRYVAICDPLRYTTILTN
SRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSYCYHPDVIQLACSDIRANSICGLIDLILTTG
IDTPCIVLSYILIIHSVLRIASPEEWHKVFSTCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRVVHSVMAN
VYLLLPPVLNPIIDSVKTKQIRKAMLSLLLTK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001004752
ORF Size 936 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001004752.1, NP_001004752.1
RefSeq Size 939 bp
RefSeq ORF 960 bp
Locus ID 256892
Cytogenetics 11p15.4
Protein Families Transmembrane
Protein Pathways Olfactory transduction
MW 34.8 kDa
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. [provided by RefSeq, Jun 2015]
Write Your Own Review
You're reviewing:OR51F1 (NM_001004752) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222268L3 Lenti ORF clone of Human olfactory receptor, family 51, subfamily F, member 1 (OR51F1), Myc-DDK-tagged 10 ug
$600.00
RC222268L4 Lenti ORF clone of Human olfactory receptor, family 51, subfamily F, member 1 (OR51F1), mGFP tagged 10 ug
$600.00
RG222268 OR51F1 (tGFP-tagged) - Human olfactory receptor, family 51, subfamily F, member 1 (OR51F1) 10 ug
$500.00
SC300790 OR51F1 (untagged)-Human olfactory receptor, family 51, subfamily F, member 1 (OR51F1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.