N acetyl transferase 5 (NAA20) (NM_181527) Human Tagged ORF Clone

SKU
RC222201
NAA20 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
2 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol N acetyl transferase 5
Synonyms dJ1002M8.1; NAT3; NAT3P; NAT5; NAT5P
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222201 representing NM_181527
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTCAGTCATGTAACTTGGATCCACTTACAGAAACTTATGGGATTCCTTTCTACCTACAATACC
TCGCCCACTGGCCAGAGTATTTCATTGTTGCAGAGGCACCTGGTGGAGAATTAATGGGTTATATTATGGG
TAAAGCAGAAGGCTCAGTAGCTAGGGAAGAATGGCACGGGCACGTCACAGCTCTGTCTGTTGCCCCAGAA
TTTCGACGCCTTGGTTTGGCTGCTAAACTTATGGAGTTACTAGAGGAGATTTCAGAAAGAAAGGGTGGAT
TTTTTGTGGATCTCTTTGTAAGAGTATCTAACCAAGTTGCAGTTAACATGTACAAGCAGTTGGGCTACAG
TGTATATAGGACGGTCATAGAGTACTATTCGGCCAGCAACGGGGAGCCTGATGAGGACGCTTATGATATG
AGGAAAGCACTTTCCAGGGATACTGAGAAGAAATCCATCATACCATTACCTCATCCTGTGAGGCCTGAAG
ACATTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222201 representing NM_181527
Red=Cloning site Green=Tags(s)

MLSQSCNLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPE
FRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDM
RKALSRDTEKKSIIPLPHPVRPEDIE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181527
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181527.3, NP_852668.1
RefSeq Size 1189 bp
RefSeq ORF 501 bp
Locus ID 51126
Cytogenetics 20p11.23
Protein Pathways Glycerophospholipid metabolism, Limonene and pinene degradation, Phenylalanine metabolism, Tyrosine metabolism
MW 18.9 kDa
Summary NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 2009]
Write Your Own Review
You're reviewing:N acetyl transferase 5 (NAA20) (NM_181527) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222201L3 Lenti-ORF clone of NAA20 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 2 10 ug
$465.00
RC222201L4 Lenti-ORF clone of NAA20 (mGFP-tagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 2 10 ug
$465.00
RG222201 NAA20 (tGFP-tagged) - Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 2 10 ug
$365.00
SC307297 NAA20 (untagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.