SOX14 (NM_004189) Human Tagged ORF Clone

SKU
RC222052
SOX14 (Myc-DDK-tagged)-Human SRY (sex determining region Y)-box 14 (SOX14)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SOX14
Synonyms SOX28
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222052 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAAACCTTCAGACCACATCAAGCGGCCCATGAACGCCTTCATGGTATGGTCCCGGGGCCAGCGGC
GCAAGATGGCCCAGGAAAACCCCAAGATGCACAACTCGGAGATCAGCAAACGCCTAGGTGCCGAATGGAA
GCTTCTGTCCGAGGCAGAGAAGCGGCCATACATCGATGAAGCCAAGCGGCTACGCGCCCAGCACATGAAG
GAGCACCCTGACTACAAGTACCGACCTCGGCGCAAGCCCAAGAACCTGCTCAAGAAGGACAGGTATGTCT
TCCCCTTGCCCTACCTGGGCGACACGGACCCGCTCAAGGCGGCTGGCCTGCCCGTGGGGGCCTCCGACGG
CCTCCTGAGCGCGCCCGAGAAAGCCCGGGCCTTCTTGCCGCCGGCCTCGGCGCCCTACTCCCTGCTGGAC
CCCGCGCAGTTTAGCTCGAGCGCCATCCAGAAGATGGGCGAAGTGCCCCACACCTTGGCTACCGGCGCTC
TGCCCTACGCGTCCACCCTGGGCTACCAGAACGGCGCCTTCGGCAGCCTCAGCTGCCCCAGCCAGCACAC
GCACACGCACCCGTCCCCCACCAACCCTGGCTACGTGGTGCCCTGTAACTGTACCGCCTGGTCTGCCTCC
ACCCTGCAGCCCCCCGTCGCCTACATCCTCTTCCCAGGCATGACCAAGACTGGCATAGACCCTTATTCGT
CAGCCCACGCTACGGCCATG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222052 protein sequence
Red=Cloning site Green=Tags(s)

MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMK
EHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLD
PAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSAS
TLQPPVAYILFPGMTKTGIDPYSSAHATAM

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_004189
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004189.4
RefSeq Size 2043 bp
RefSeq ORF 723 bp
Locus ID 8403
UniProt ID O95416
Cytogenetics 3q22.3
Domains HMG
Protein Families Transcription Factors
MW 26.5 kDa
Summary This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SOX14 (NM_004189) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222052L3 Lenti ORF clone of Human SRY (sex determining region Y)-box 14 (SOX14), Myc-DDK-tagged 10 ug
$600.00
RC222052L4 Lenti ORF clone of Human SRY (sex determining region Y)-box 14 (SOX14), mGFP tagged 10 ug
$600.00
RG222052 SOX14 (tGFP-tagged) - Human SRY (sex determining region Y)-box 14 (SOX14) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108393 SOX14 (untagged)-Human SRY (sex determining region Y)-box 14 (SOX14) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.