PLP2 (NM_002668) Human Tagged ORF Clone

SKU
RC222024
PLP2 (Myc-DDK-tagged)-Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PLP2
Synonyms A4; A4LSB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222024 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATTCTGAGCGCCTCTCGGCTCCTGGCTGCTGGGCCGCCTGCACCAACTTCTCGCGCACTCGAA
AGGGAATCCTCCTGTTTGCTGAGATTATATTATGCCTGGTGATCCTGATCTGCTTCAGTGCCTCCACACC
AGGCTACTCCTCCCTGTCGGTGATTGAGATGATCCTTGCTGCTATTTTCTTTGTTGTCTACATGTGTGAC
CTGCACACCAAGATACCATTCATCAACTGGCCCTGGAGTGATTTCTTCCGAACCCTCATAGCGGCAATCC
TCTACCTGATCACCTCCATTGTTGTCCTTGTTGAGAGAGGAAACCACTCCAAAATCGTCGCAGGGGTACT
GGGCCTAATCGCTACGTGCCTCTTTGGCTATGATGCCTATGTCACCTTCCCCGTTCGGCAGCCAAGACAT
ACAGCAGCCCCCACTGACCCCGCAGATGGCCCGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222024 protein sequence
Red=Cloning site Green=Tags(s)

MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCD
LHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRH
TAAPTDPADGPV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002668
ORF Size 456 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002668.3
RefSeq Size 1049 bp
RefSeq ORF 459 bp
Locus ID 5355
UniProt ID Q04941
Cytogenetics Xp11.23
Protein Families Transmembrane
MW 16.7 kDa
Summary This gene encodes an integral membrane protein that localizes to the endoplasmic reticulum in colonic epithelial cells. The encoded protein can multimerize and may function as an ion channel. A polymorphism in the promoter of this gene may be linked to an increased risk of X-linked cognitive disability. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Jan 2010]
Write Your Own Review
You're reviewing:PLP2 (NM_002668) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222024L1 Lenti ORF clone of Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2), Myc-DDK-tagged 10 ug
$450.00
RC222024L2 Lenti ORF clone of Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2), mGFP tagged 10 ug
$450.00
RC222024L3 Lenti ORF clone of Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2), Myc-DDK-tagged 10 ug
$450.00
RC222024L4 Lenti ORF clone of Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2), mGFP tagged 10 ug
$450.00
RG222024 PLP2 (tGFP-tagged) - Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2) 10 ug
$489.00
SC118502 PLP2 (untagged)-Human proteolipid protein 2 (colonic epithelium-enriched) (PLP2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.