LCE3C (NM_178434) Human Tagged ORF Clone

SKU
RC221967
LCE3C (Myc-DDK-tagged)-Human late cornified envelope 3C (LCE3C)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LCE3C
Synonyms LEP15; SPRL3A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221967 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTGCCAGCAAAACCAGCAGCAGTGCCAGCCCCCTCCCAGTTGTCCCTCACCCAAGTGTCCCCCAA
AGAGCCCAGCACAGTGTCTGCCTCCACCCTCTTCTGACTGTGCTCTAAGCTCCGGGGGCTGTGGCCCCAG
TTCTGAAAGTGGCTGCTGCCTGAGCCACCACAGGCACTTCAGGTCCCATCAATGCCGGCGCCAGAGATCC
AACTCCTGTGACAGGGGCAGTGGTCAGCAAGGCGGGGGCTCCTGCCGTGGCCATGGCTCTGGGGGCTGCT
GC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221967 protein sequence
Red=Cloning site Green=Tags(s)

MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRS
NSCDRGSGQQGGGSCRGHGSGGCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178434
ORF Size 282 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178434.3
RefSeq Size 425 bp
RefSeq ORF 285 bp
Locus ID 353144
UniProt ID Q5T5A8
Cytogenetics 1q21.3
MW 9.7 kDa
Summary A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LCE3C (NM_178434) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221967L3 Lenti ORF clone of Human late cornified envelope 3C (LCE3C), Myc-DDK-tagged 10 ug
$450.00
RC221967L4 Lenti ORF clone of Human late cornified envelope 3C (LCE3C), mGFP tagged 10 ug
$450.00
RG221967 LCE3C (tGFP-tagged) - Human late cornified envelope 3C (LCE3C) 10 ug
$489.00
SC307177 LCE3C (untagged)-Human late cornified envelope 3C (LCE3C) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.