TGIF2LX (NM_138960) Human Tagged ORF Clone

SKU
RC221767
TGIF2LX (Myc-DDK-tagged)-Human TGFB-induced factor homeobox 2-like, X-linked (TGIF2LX)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TGIF2LX
Synonyms TGIFLX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221767 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCGCTGCGGACGGCCCGGCTGAGACCCAAAGCCCGGTGGAAAAAGACAGCCCGGCGAAGACCC
AAAGCCCAGCCCAAGACACCTCAATCATGTCGAGAAATAACGCAGATACAGGCAGAGTTCTTGCCTTACC
AGAGCACAAGAAGAAGCGCAAGGGAAACTTGCCAGCCGAGTCCGTTAAGATCCTCCGCGACTGGATGTAT
AAGCATCGGTTTAAGGCCTACCCTTCAGAAGAAGAGAAGCAAATGCTGTCAGAGAAGACCAATTTGTCTT
TGTTGCAGATTTCTAACTGGTTTATCAATGCTCGCAGACGCATTCTCCCGGATATGCTTCAACAGCGTAG
AAACGACCCCATCATTGGCCACAAAACGGGCAAAGATGCCCATGCCACCCACCTGCAGAGCACCGAGGCG
TCTGTGCCGGCCAAGTCAGGGCCCAGTGGTCCAGACAATGTACAAAGCCTGCCCCTGTGGCCCTTGCCAA
AGGGCCAGATGTCAAGAGAGAAGCAACCAGATCCGGAGTCGGCCCCTAGCCAGAAGCTCACCGGAATAGC
CCAGCCGAAGAAAAAGGTCAAGGTTTCTATCACATCCCCGTCTTCTCCAGAACTTGTGTCTCCAGAGGAG
CACGCCGACTTCAGCAGCTTCCTGCTGCTAGTCGATGCAGCAGTACAAAGGGCTGCCGAGCTGGAGCTAG
AGAAGAAGCAAGAGCCTAATCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221767 protein sequence
Red=Cloning site Green=Tags(s)

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMY
KHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEA
SVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSITSPSSPELVSPEE
HADFSSFLLLVDAAVQRAAELELEKKQEPNP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138960
ORF Size 723 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138960.1
RefSeq Size 881 bp
RefSeq ORF 726 bp
Locus ID 90316
UniProt ID Q8IUE1
Cytogenetics Xq21.31
Protein Families Transcription Factors
MW 26.7 kDa
Summary This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TGIF2LX (NM_138960) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221767L3 Lenti ORF clone of Human TGFB-induced factor homeobox 2-like, X-linked (TGIF2LX), Myc-DDK-tagged 10 ug
$600.00
RC221767L4 Lenti ORF clone of Human TGFB-induced factor homeobox 2-like, X-linked (TGIF2LX), mGFP tagged 10 ug
$600.00
RG221767 TGIF2LX (tGFP-tagged) - Human TGFB-induced factor homeobox 2-like, X-linked (TGIF2LX) 10 ug
$500.00
SC306095 TGIF2LX (untagged)-Human TGFB-induced factor homeobox 2-like, X-linked (TGIF2LX) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.