FGF16 (NM_003868) Human Tagged ORF Clone

SKU
RC221629
FGF16 (Myc-DDK-tagged)-Human fibroblast growth factor 16 (FGF16)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FGF16
Synonyms FGF-16; MF4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221629 representing NM_003868
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGGTGGGGGGCGTCTTCGCCTCCTTGGACTGGGATCTACACGGCTTCTCCTCGTCTCTGGGGA
ACGTGCCCTTAGCTGACTCCCCAGGTTTCCTGAACGAGCGCCTGGGCCAAATCGAGGGGAAGCTGCAGCG
TGGCTCACCCACAGACTTCGCCCACCTGAAGGGGATCCTGCGGCGCCGCCAGCTCTACTGCCGCACCGGC
TTCCACCTGGAGATCTTCCCCAACGGCACGGTGCACGGGACCCGCCACGACCACAGCCGCTTCGGAATCC
TGGAGTTTATCAGCCTGGCTGTGGGGCTGATCAGCATCCGGGGAGTGGACTCTGGCCTGTACCTAGGAAT
GAATGAGCGAGGAGAACTCTATGGGTCGAAGAAACTCACACGTGAATGTGTTTTCCGGGAACAGTTTGAA
GAAAACTGGTACAACACCTATGCCTCAACCTTGTACAAACATTCGGACTCAGAGAGACAGTATTACGTGG
CCCTGAACAAAGATGGCTCACCCCGGGAGGGATACAGGACTAAACGACACCAGAAATTCACTCACTTTTT
ACCCAGGCCTGTAGATCCTTCTAAGTTGCCCTCCATGTCCAGAGACCTCTTTCACTATAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221629 representing NM_003868
Red=Cloning site Green=Tags(s)

MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTG
FHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFE
ENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003868
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003868.1, NP_003859.1
RefSeq Size 624 bp
RefSeq ORF 624 bp
Locus ID 8823
UniProt ID O43320
Cytogenetics Xq21.1
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
MW 23.6 kDa
Summary This gene encodes a member of a family of proteins that are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene is expressed in cardiac cells and is required for proper heart development. Mutation in this gene was also observed in individuals with metacarpal 4-5 fusion. [provided by RefSeq, Mar 2014]
Write Your Own Review
You're reviewing:FGF16 (NM_003868) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221629L1 Lenti ORF clone of Human fibroblast growth factor 16 (FGF16), Myc-DDK-tagged 10 ug
$600.00
RC221629L2 Lenti ORF clone of Human fibroblast growth factor 16 (FGF16), mGFP tagged 10 ug
$600.00
RC221629L3 Lenti ORF clone of Human fibroblast growth factor 16 (FGF16), Myc-DDK-tagged 10 ug
$600.00
RC221629L4 Lenti ORF clone of Human fibroblast growth factor 16 (FGF16), mGFP tagged 10 ug
$600.00
RG221629 FGF16 (tGFP-tagged) - Human fibroblast growth factor 16 (FGF16) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303395 FGF16 (untagged)-Human fibroblast growth factor 16 (FGF16) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.