ARMET (MANF) (NM_006010) Human Tagged ORF Clone

SKU
RC221555
MANF (Myc-DDK-tagged)-Human mesencephalic astrocyte-derived neurotrophic factor (MANF)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARMET
Synonyms ARMET; ARP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221555 representing NM_006010
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAGGATGAGGAGGATGTGGGCCACGCAGGGGCTGGCGGTGGCGCTGGCTCTGAGCGTGCTGCCGG
GCAGCCGGGCGCTGCGGCCGGGCGACTGCGAAGTTTGTATTTCTTATCTGGGAAGATTTTACCAGGACCT
CAAAGACAGAGATGTCACATTCTCACCAGCCACTATTGAAAACGAACTTATAAAGTTCTGCCGGGAAGCA
AGAGGCAAAGAGAATCGGTTGTGCTACTATATCGGGGCCACAGATGATGCAGCCACCAAAATCATCAATG
AGGTATCAAAGCCTCTGGCCCACCACATCCCTGTGGAGAAGATCTGTGAGAAGCTTAAGAAGAAGGACAG
CCAGATATGTGAGCTTAAGTATGACAAGCAGATCGACCTGAGCACAGTGGACCTGAAGAAGCTCCGAGTT
AAAGAGCTGAAGAAGATTCTGGATGACTGGGGGGAGACATGCAAAGGCTGTGCAGAAAAGTCTGACTACA
TCCGGAAGATAAATGAACTGATGCCTAAATATGCCCCCAAGGCAGCCAGTGCACGGACCGATTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221555 representing NM_006010
Red=Cloning site Green=Tags(s)

MRRMRRMWATQGLAVALALSVLPGSRALRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREA
RGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRV
KELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006010
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006010.5, NP_006001.4
RefSeq Size 993 bp
RefSeq ORF 549 bp
Locus ID 7873
UniProt ID P55145
Cytogenetics 3p21.2
Protein Families Druggable Genome, Secreted Protein
MW 21.6 kDa
Summary The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and results in cell proliferation. Activity of this protein is important in promoting the survival of dopaminergic neurons. The presence of polymorphisms in the N-terminal arginine-rich region, including a specific mutation that changes an ATG start codon to AGG, have been reported in a variety of solid tumors; however, these polymorphisms were later shown to exist in normal tissues and are thus no longer thought to be tumor-related. [provided by RefSeq, Apr 2014]
Write Your Own Review
You're reviewing:ARMET (MANF) (NM_006010) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221555L1 Lenti ORF clone of Human mesencephalic astrocyte-derived neurotrophic factor (MANF), Myc-DDK-tagged 10 ug
$600.00
RC221555L2 Lenti ORF clone of Human mesencephalic astrocyte-derived neurotrophic factor (MANF), mGFP tagged 10 ug
$600.00
RC221555L3 Lenti ORF clone of Human mesencephalic astrocyte-derived neurotrophic factor (MANF), Myc-DDK-tagged 10 ug
$600.00
RC221555L4 Lenti ORF clone of Human mesencephalic astrocyte-derived neurotrophic factor (MANF), mGFP tagged 10 ug
$600.00
RG221555 MANF (tGFP-tagged) - Human mesencephalic astrocyte-derived neurotrophic factor (MANF) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122734 MANF (untagged)-Human mesencephalic astrocyte-derived neurotrophic factor (MANF) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.