Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone
SKU
RC221140
CAV3 (Myc-DDK-tagged)-Human caveolin 3 (CAV3), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | Caveolin 3 |
Synonyms | LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC221140 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGGCAGAAGAGCACACAGATCTCGAGGCCCAGATCGTCAAGGATATCCACTGCAAGGAGATTGACC TGGTGAACCGAGACCCCAAGAACATTAACGAGGACATAGTCAAGGTGGATTTTGAAGACGTGATCGCAGA GCCTGTGGGCACCTACAGCTTTGACGGCGTGTGGAAGGTGAGCTACACCACCTTCACTGTCTCCAAGTAC TGGTGCTACCGTCTGTTGTCCACGCTGCTGGGCGTCCCACTGGCCCTGCTCTGGGGCTTCCTGTTCGCCT GCATCTCCTTCTGCCACATCTGGGCGGTGGTGCCATGCATTAAGAGCTACCTGATCGAGATCCAGTGCAT CAGCCACATCTACTCACTCTGCATCCGCACCTTCTGCAACCCACTCTTCGCGGCCCTGGGCCAGGTCTGC AGCAGCATCAAGGTGGTGCTGCGGAAGGAGGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221140 protein sequence
Red=Cloning site Green=Tags(s) MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKY WCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVC SSIKVVLRKEV myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_033337 |
ORF Size | 453 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_033337.3 |
RefSeq Size | 1435 bp |
RefSeq ORF | 456 bp |
Locus ID | 859 |
UniProt ID | P56539 |
Cytogenetics | 3p25.3 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Focal adhesion |
MW | 17.3 kDa |
Summary | This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC221140L1 | Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC221140L2 | Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RC221140L3 | Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC221140L4 | Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RG221140 | CAV3 (tGFP-tagged) - Human caveolin 3 (CAV3), transcript variant 1 | 10 ug |
$489.00
|
|
SC305616 | CAV3 (untagged)-Human caveolin 3 (CAV3), transcript variant 1 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.