TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone

SKU
RC221007
TNFSF12 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TWEAK
Synonyms APO3L; DR3LG; TNLG4A; TWEAK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221007 representing NM_003809
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCGGCGC
GCC
C

ATGGCCGCCCGTCGGAGCCAGAGGCGGAGGGGGCGCCGGGGGGAGCCGGGCACCGCCCTGCTGGTCCCGC
TCGCGCTGGGCCTGGGCCTGGCGCTGGCCTGCCTCGGCCTCCTGCTGGCCGTGGTCAGTTTGGGGAGCCG
GGCATCGCTGTCCGCCCAGGAGCCTGCCCAGGAGGAGCTGGTGGCAGAGGAGGACCAGGACCCGTCGGAA
CTGAATCCCCAGACAGAAGAAAGCCAGGATCCTGCGCCTTTCCTGAACCGACTAGTTCGGCCTCGCAGAA
GTGCACCTAAAGGCCGGAAAACACGGGCTCGAAGAGCGATCGCAGCCCATTATGAAGTTCATCCACGACC
TGGACAGGACGGAGCGCAGGCAGGTGTGGACGGGACAGTGAGTGGCTGGGAGGAAGCCAGAATCAACAGC
TCCAGCCCTCTGCGCTACAACCGCCAGATCGGGGAGTTTATAGTCACCCGGGCTGGGCTCTACTACCTGT
ACTGTCAGGTGCACTTTGATGAGGGGAAGGCTGTCTACCTGAAGCTGGACTTGCTGGTGGATGGTGTGCT
GGCCCTGCGCTGCCTGGAGGAATTCTCAGCCACTGCGGCGAGTTCCCTCGGGCCCCAGCTCCGCCTCTGC
CAGGTGTCTGGGCTGTTGGCCCTGCGGCCAGGGTCCTCCCTGCGGATCCGCACCCTCCCCTGGGCCCATC
TCAAGGCTGCCCCCTTCCTCACCTACTTCGGACTCTTCCAGGTTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221007 representing NM_003809
Red=Cloning site Green=Tags(s)

MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSE
LNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINS
SSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLC
QVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites AscI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003809
ORF Size 747 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003809.3
RefSeq Size 1407 bp
RefSeq ORF 750 bp
Locus ID 8742
UniProt ID O43508
Cytogenetics 17p13.1
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
MW 27.22 kDa
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine, which exists in both membrane-bound and secreted forms, can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Alternative splicing results in multiple transcript variants. Some transcripts skip the last exon of this gene and continue into the second exon of the neighboring TNFSF13 gene; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]
Write Your Own Review
You're reviewing:TWEAK (TNFSF12) (NM_003809) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221007L1 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC221007L2 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, mGFP tagged 10 ug
$750.00
RC221007L3 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC221007L4 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1, mGFP tagged 10 ug
$750.00
RG221007 TNFSF12 (tGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1 10 ug
$650.00
SC303382 TNFSF12 (untagged)-Human tumor necrosis factor (ligand) superfamily, member 12 (TNFSF12), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.