CT45A2 (NM_152582) Human Tagged ORF Clone

SKU
RC220942
CT45A2 (Myc-DDK-tagged)-Human cancer/testis antigen family 45, member A2 (CT45A2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CT45A2
Synonyms CT45-2; CT45.2; CT45A8; CT45A9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220942 representing NM_152582
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGATAAAACAGAGAAGGTGGCTGTAGATCCTGAAACTGTGTTTAAACGTCCCAGGGAATGTGACA
GTCCTTCGTATCAGAAAAGGCAGAGGATGGCCCTGTTGGCAAGGAAACAAGGAGCAGGAGACAGCCTTAT
TGCAGGCTCTGCCATGTCCAAAGAAAAGAAGCTTATGACAGGACATGCTATTCCACCCAGCCAATTGGAT
TCTCAGATTGATGACTTCACTGGTTTCAGCAAAGATAGGATGATGCAGAAACCTGGTAGCAATGCACCTG
TGGGAGGAAACGTTACCAGCAGTTTCTCTGGAGATGACCTAGAATGCAGAGAAACAGCCTCCTCTCCCAA
AAGCCAACGAGAAATTAATGCTGATATAAAACGTAAATTAGTGAAGGAACTCCGATGCGTTGGACAAAAA
TATGAAAAAATCTTCGAAATGCTTGAAGGAGTGCAAGGACCTACTGCAGTCAGGAAGCGATTTTTTGAAT
CCATCATCAAGGAAGCAGCAAGATGTATGAGACGAGACTTTGTTAAGCACCTTAAGAAGAAACTGAAACG
TATGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220942 representing NM_152582
Red=Cloning site Green=Tags(s)

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152582
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152582.1
RefSeq Size 1032 bp
RefSeq ORF 570 bp
Locus ID 728911
UniProt ID Q5DJT8
Cytogenetics Xq26.3
MW 21.1 kDa
Summary This gene represents one of a cluster of several similar genes located on the q arm of chromosome X. The genes in this cluster encode members of the cancer/testis (CT) family of antigens, and are distinct from other CT antigens. These antigens are thought to be novel therapeutic targets for human cancers. [provided by RefSeq, Apr 2014]
Write Your Own Review
You're reviewing:CT45A2 (NM_152582) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220942L1 Lenti ORF clone of Human cancer/testis antigen family 45, member A2 (CT45A2), Myc-DDK-tagged 10 ug
$600.00
RC220942L2 Lenti ORF clone of Human cancer/testis antigen family 45, member A2 (CT45A2), mGFP tagged 10 ug
$600.00
RC220942L3 Lenti ORF clone of Human cancer/testis antigen family 45, member A2 (CT45A2), Myc-DDK-tagged 10 ug
$600.00
RC220942L4 Lenti ORF clone of Human cancer/testis antigen family 45, member A2 (CT45A2), mGFP tagged 10 ug
$600.00
RG220942 CT45A2 (tGFP-tagged) - Human cancer/testis antigen family 45, member A2 (CT45A2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC123264 CT45A2 (untagged)-Human cancer/testis antigen family 45, member A2 (CT45A2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.