SLIT2 (NM_004787) Human Tagged ORF Clone

CAT#: RC220894

Reviews ()
Write a review

SLIT2 (Myc-DDK-tagged)-Human slit homolog 2 (Drosophila) (SLIT2)



Reconstitution Protocol

USD 1,961.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SLIT2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLIT2
Synonyms SLIL3; Slit-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220894 representing NM_004787
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCGGCGTTGGCTGGCAGATGCTGTCCCTGTCGCTGGGGTTAGTGCTGGCGATCCTGAACAAGGTGG
CACCGCAGGCGTGCCCGGCGCAGTGCTCTTGCTCGGGCAGCACAGTGGACTGTCACGGGCTGGCGCTGCG
CAGCGTGCCCAGGAATATCCCCCGCAACACCGAGAGACTGGATTTAAATGGAAATAACATCACAAGAATT
ACGAAGACAGATTTTGCTGGTCTTAGACATCTAAGAGTTCTTCAGCTTATGGAGAATAAGATTAGCACCA
TTGAAAGAGGAGCATTCCAGGATCTTAAAGAACTAGAGAGACTGCGTTTAAACAGAAATCACCTTCAGCT
GTTTCCTGAGTTGCTGTTTCTTGGGACTGCGAAGCTATACAGGCTTGATCTCAGTGAAAACCAAATTCAG
GCAATCCCAAGGAAAGCTTTCCGTGGGGCAGTTGACATAAAAAATTTGCAACTGGATTACAACCAGATCA
GCTGTATTGAAGATGGGGCATTCAGGGCTCTCCGGGACCTGGAAGTGCTCACTCTCAACAATAACAACAT
TACTAGACTTTCTGTGGCAAGTTTCAACCATATGCCTAAACTTAGGACTTTTCGACTGCATTCAAACAAC
CTGTATTGTGACTGCCACCTGGCCTGGCTCTCCGACTGGCTTCGCCAAAGGCCTCGGGTTGGTCTGTACA
CTCAGTGTATGGGCCCCTCCCACCTGAGAGGCCATAATGTAGCCGAGGTTCAAAAACGAGAATTTGTCTG
CAGTGGTCACCAGTCATTTATGGCTCCTTCTTGTAGTGTTTTGCACTGCCCTGCCGCCTGTACCTGTAGC
AACAATATCGTAGACTGTCGTGGGAAAGGTCTCACTGAGATCCCCACAAATCTTCCAGAGACCATCACAG
AAATACGTTTGGAACAGAACACAATCAAAGTCATCCCTCCTGGAGCTTTCTCACCATATAAAAAGCTTAG
ACGAATTGACCTGAGCAATAATCAGATCTCTGAACTTGCACCAGATGCTTTCCAAGGACTACGCTCTCTG
AATTCACTTGTCCTCTATGGAAATAAAATCACAGAACTCCCCAAAAGTTTATTTGAAGGACTGTTTTCCT
TACAGCTCCTATTATTGAATGCCAACAAGATAAACTGCCTTCGGGTAGATGCTTTTCAGGATCTCCACAA
CTTGAACCTTCTCTCCCTATATGACAACAAGCTTCAGACCATCGCCAAGGGGACCTTTTCACCTCTTCGG
GCCATTCAAACTATGCATTTGGCCCAGAACCCCTTTATTTGTGACTGCCATCTCAAGTGGCTAGCGGATT
ATCTCCATACCAACCCGATTGAGACCAGTGGTGCCCGTTGCACCAGCCCCCGCCGCCTGGCAAACAAAAG
AATTGGACAGATCAAAAGCAAGAAATTCCGTTGTTCAGCTAAAGAACAGTATTTCATTCCAGGTACAGAA
GATTATCGATCAAAATTAAGTGGAGACTGCTTTGCGGATCTGGCTTGCCCTGAAAAGTGTCGCTGTGAAG
GAACCACAGTAGATTGCTCTAATCAAAAGCTCAACAAAATCCCGGAGCACATTCCCCAGTACACTGCAGA
GTTGCGTCTCAATAATAATGAATTTACCGTGTTGGAAGCCACAGGAATCTTTAAGAAACTTCCTCAATTA
CGTAAAATAAACTTTAGCAACAATAAGATCACAGATATTGAGGAGGGAGCATTTGAAGGAGCATCTGGTG
TAAATGAAATACTTCTTACGAGTAATCGTTTGGAAAATGTGCAGCATAAGATGTTCAAGGGATTGGAAAG
CCTCAAAACTTTGATGTTGAGAAGCAATCGAATAACCTGTGTGGGGAATGACAGTTTCATAGGACTCAGT
TCTGTGCGTTTGCTTTCTTTGTATGATAATCAAATTACTACAGTTGCACCAGGGGCATTTGATACTCTCC
ATTCTTTATCTACTCTAAACCTCTTGGCCAATCCTTTTAACTGTAACTGCTACCTGGCTTGGTTGGGAGA
GTGGCTGAGAAAGAAGAGAATTGTCACGGGAAATCCTAGATGTCAAAAACCATACTTCCTGAAAGAAATA
CCCATCCAGGATGTGGCCATTCAGGACTTCACTTGTGATGACGGAAATGATGACAATAGTTGCTCCCCAC
TTTCTCGCTGTCCTACTGAATGTACTTGCTTGGATACAGTCGTCCGATGTAGCAACAAGGGTTTGAAGGT
CTTGCCGAAAGGTATTCCAAGAGATGTCACAGAGTTGTATCTGGATGGAAACCAATTTACACTGGTTCCC
AAGGAACTCTCCAACTACAAACATTTAACACTTATAGACTTAAGTAACAACAGAATAAGCACGCTTTCTA
ATCAGAGCTTCAGCAACATGACCCAGCTCCTCACCTTAATTCTTAGTTACAACCGTCTGAGATGTATTCC
TCCTCGCACCTTTGATGGATTAAAGTCTCTTCGATTACTTTCTCTACATGGAAATGACATTTCTGTTGTG
CCTGAAGGTGCTTTCAATGATCTTTCTGCATTATCACATCTAGCAATTGGAGCCAACCCTCTTTACTGTG
ATTGTAACATGCAGTGGTTATCCGACTGGGTGAAGTCGGAATATAAGGAGCCTGGAATTGCTCGTTGTGC
TGGTCCTGGAGAAATGGCAGATAAACTTTTACTCACAACTCCCTCCAAAAAATTTACCTGTCAAGGTCCT
GTGGATGTCAATATTCTAGCTAAGTGTAACCCCTGCCTATCAAATCCGTGTAAAAATGATGGCACATGTA
ATAGTGATCCAGTTGACTTTTACCGATGCACCTGTCCATATGGTTTCAAGGGGCAGGACTGTGATGTCCC
AATTCATGCCTGCATCAGTAACCCATGTAAACATGGAGGAACTTGCCACTTAAAGGAAGGAGAAGAAGAT
GGATTCTGGTGTATTTGTGCTGATGGATTTGAAGGAGAAAATTGTGAAGTCAACGTTGATGATTGTGAAG
ATAATGACTGTGAAAATAATTCTACATGTGTCGATGGCATTAATAACTACACATGCCTTTGCCCACCTGA
GTATACAGGTGAGTTGTGTGAGGTGAAGCTGGACTTCTGTGCCCAGGACCTGAACCCCTGCCAGCACGAT
TCAAAGTGCATCCTAACTCCAAAGGGATTCAAATGTGACTGCACACCAGGGTACGTAGGTGAACACTGCG
ACATCGATTTTGACGACTGCCAAGACAACAAGTGTAAAAACGGAGCCCACTGCACAGATGCAGTGAACGG
CTATACGTGCATATGCCCCGAAGGTTACAGTGGCTTGTTCTGTGAGTTTTCTCCACCCATGGTCCTCCCT
CGTACCAGCCCCTGTGATAATTTTGATTGTCAGAATGGAGCTCAGTGTATCGTCAGAATAAATGAGCCAA
TATGTCAGTGTTTGCCTGGCTATCAGGGAGAAAAGTGTGAAAAATTGGTTAGTGTGAATTTTATAAACAA
AGAGTCTTATCTTCAGATTCCTTCAGCCAAGGTTCGGCCTCAGACGAACATAACACTTCAGATTGCCACA
GATGAAGACAGCGGAATCCTCCTGTATAAGGGTGACAAAGACCATATCGCGGTAGAACTCTATCGGGGGC
GTGTTCGTGCCAGCTATGACACCGGCTCTCATCCAGCTTCTGCCATTTACAGTGTGGAGACAATCAATGA
TGGAAACTTCCACATTGTGGAACTACTTGCCTTGGATCAGAGTCTCTCTTTGTCCGTGGATGGTGGGAAC
CCCAAAATCATCACTAACTTGTCAAAGCAGTCCACTCTGAATTTTGACTCTCCACTCTATGTAGGAGGCA
TGCCAGGGAAGAGTAACGTGGCATCTCTGCGCCAGGCCCCTGGGCAGAACGGAACCAGCTTCCACGGCTG
CATCCGGAACCTTTACATCAACAGTGAGCTGCAGGACTTCCAGAAGGTGCCGATGCAAACAGGCATTTTG
CCTGGCTGTGAGCCATGCCACAAGAAGGTGTGTGCCCATGGCACATGCCAGCCCAGCAGCCAGGCAGGCT
TCACCTGCGAGTGCCAGGAAGGATGGATGGGGCCCCTCTGTGACCAACGGACCAATGACCCTTGCCTTGG
AAATAAATGCGTACATGGCACCTGCTTGCCCATCAATGCGTTCTCCTACAGCTGTAAGTGCTTGGAGGGC
CATGGAGGTGTCCTCTGTGATGAAGAGGAGGATCTGTTTAACCCATGCCAGGCGATCAAGTGCAAGCATG
GGAAGTGCAGGCTTTCAGGTCTGGGGCAGCCCTACTGTGAATGCAGCAGTGGATACACGGGGGACAGCTG
TGATCGAGAAATCTCTTGTCGAGGGGAAAGGATAAGAGATTATTACCAAAAGCAGCAGGGCTATGCTGCT
TGCCAAACAACCAAGAAGGTGTCCCGATTAGAGTGCAGAGGTGGGTGTGCAGGAGGGCAGTGCTGTGGAC
CGCTGAGGAGCAAGCGGCGGAAATACTCTTTCGAATGCACTGACGGCTCCTCCTTTGTGGACGAGGTTGA
GAAAGTGGTGAAGTGCGGCTGTACGAGGTGTGTGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220894 representing NM_004787
Red=Cloning site Green=Tags(s)

MRGVGWQMLSLSLGLVLAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRI
TKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQ
AIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNN
LYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCS
NNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSL
NSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR
AIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTE
DYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQL
RKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLS
SVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEI
PIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVP
KELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVV
PEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGP
VDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLKEGEED
GFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEVKLDFCAQDLNPCQHD
SKCILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLP
RTSPCDNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQIAT
DEDSGILLYKGDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGN
PKIITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQTGIL
PGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEG
HGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRDYYQKQQGYAA
CQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVDEVEKVVKCGCTRCVS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004787
ORF Size 4587 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004787.4
RefSeq Size 4950 bp
RefSeq ORF 4590 bp
Locus ID 9353
UniProt ID O94813
Cytogenetics 4p15.31
Domains LRRNT, LRRCT, LRR, LamG, EGF_CA, LRR_TYP, CT, EGF, EGF, LRR_PS
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Axon guidance
MW 169.7 kDa
Gene Summary This gene encodes a member of the slit family of secreted glycoproteins, which are ligands for the Robo family of immunoglobulin receptors. Slit proteins play highly conserved roles in axon guidance and neuronal migration and may also have functions during other cell migration processes including leukocyte migration. Members of the slit family are characterized by an N-terminal signal peptide, four leucine-rich repeats, nine epidermal growth factor repeats, and a C-terminal cysteine knot. Proteolytic processing of this protein gives rise to an N-terminal fragment that contains the four leucine-rich repeats and five epidermal growth factor repeats and a C-terminal fragment that contains four epidermal growth factor repeats and the cysteine knot. Both full length and cleaved proteins are secreted extracellularly and can function in axon repulsion as well as other specific processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.