UCK (UCK1) (NM_031432) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC220876
UCK1 (Myc-DDK-tagged)-Human uridine-cytidine kinase 1 (UCK1), transcript variant 1
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UCK
Synonyms URK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220876 representing NM_031432
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCGGCGGGAGGCGAAGACTGCGAGAGCCCCGCGCCGGAGGCCGACCGTCCGCACCAGCGGCCCT
TCCTGATAGGGGTGAGCGGCGGCACTGCCAGCGGGAAGTCGACCGTGTGTGAGAAGATCATGGAGTTGCT
GGGACAGAACGAGGTGGAACAGCGGCAGCGGAAGGTGGTCATCCTGAGCCAGGACAGGTTCTACAAGGTC
CTGACGGCAGAGCAGAAGGCCAAGGCCTTGAAAGGACAGTACAATTTTGACCATCCAGATGCCTTTGATA
ATGATTTGATGCACAGGACTCTGAAGAACATCGTGGAGGGCAAAACGGTGGAGGTGCCGACCTATGATTT
TGTGACACACTCAAGGTTACCAGAGACCACGGTGGTCTACCCTGCGGACGTGGTTCTGTTTGAGGGCATC
TTGGTGTTCTACAGCCAGGAGATCCGGGACATGTTCCACCTGCGCCTCTTCGTGGACACCGACTCCGACG
TCAGGCTGTCTCGAAGAGTTCTCCGGGACGTGCGCCGAGGGAGGGACCTGGAGCAGATTCTGACGCAGTA
CACCACCTTCGTGAAGCCGGCCTTCGAGGAGTTTTGCCTGCCGACAAAGAAGTATGCCGATGTGATCATC
CCACGAGGAGTGGACAATATGGTTGCCATCAACCTGATCGTGCAGCACATCCAGGACATTCTGAATGGTG
ACATCTGCAAATGGCACCGAGGAGGGTCCAATGGGCGGAGCTACAAGCGGACCTTTTCTGAGCCAGGGGA
CCACCCTGGGATGCTGACCTCTGGCAAACGGTCACATTTGGAGTCCAGCAGCAGACCCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220876 representing NM_031432
Red=Cloning site Green=Tags(s)

MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV
LTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI
LVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVII
PRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031432
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031432.5
RefSeq Size 2160 bp
RefSeq ORF 834 bp
Locus ID 83549
UniProt ID Q9HA47
Cytogenetics 9q34.13
Domains PRK
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism
MW 31.3 kDa
Summary This gene encodes a uridine-cytidine kinase that catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP) but not the phosphorylation of deoxyribonucleosides or purine ribonucleosides. This enzyme can also phosphorylate uridine and cytidine analogs and uses both ATP and GTP as a phosphate donor. Alternative splicing results in multiple splice variants encoding distinct isoforms. [provided by RefSeq, May 2012]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC220876L1 Lenti ORF clone of Human uridine-cytidine kinase 1 (UCK1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220876L2 Lenti ORF clone of Human uridine-cytidine kinase 1 (UCK1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC220876L3 Lenti ORF clone of Human uridine-cytidine kinase 1 (UCK1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220876L4 Lenti ORF clone of Human uridine-cytidine kinase 1 (UCK1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG220876 UCK1 (tGFP-tagged) - Human uridine-cytidine kinase 1 (UCK1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC107347 UCK1 (untagged)-Human uridine-cytidine kinase 1 (UCK1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.