RFXANK (NM_003721) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC220744
RFXANK (Myc-DDK-tagged)-Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RFXANK
Synonyms ANKRA1; BLS; F14150_1; RFX-B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220744 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTTACCCAGCCTGCAGAAGACCTCATCCAGACCCAGCAGACCCCTGCCTCAGAACTTGGGGACC
CTGAAGACCCCGGAGAGGAGGCTGCAGATGGCTCAGACACTGTGGTCCTCAGTCTCTTTCCCTGCACCCC
TGAGCCTGTGAATCCTGAACCGGATGCCAGTGTTTCCTCTCCACAGGCAGGCAGCTCCCTGAAGCACTCC
ACCACTCTCACCAACCGGCAGCGAGGGAACGAGGTGTCAGCTCTGCCGGCCACCCTAGACTCCCTGTCCA
TCCACCAGCTCGCAGCACAGGGGGAGCTGGACCAGCTGAAGGAGCATTTGCGGAAAGGTGACAACCTCGT
CAACAAGCCAGACGAGCGCGGCTTCACCCCCCTCATCTGGGCCTCCGCCTTTGGAGAGATTGAGACCGTT
CGCTTCCTGCTGGAGTGGGGTGCCGACCCCCACATCCTGGCAAAAGAGCGAGAGAGCGCCCTGTCGCTGG
CCAGCACAGGCGGCTACACAGACATTGTGGGGCTGCTGCTGGAGCGTGACGTGGACATCAACATCTATGA
TTGGAATGGAGGGACGCCACTGCTGTACGCTGTGCGCGGGAACCACGTGAAATGCGTTGAGGCCTTGCTG
GCCCGAGGCGCTGACCTCACCACCGAAGCCGACTCTGGCTACACCCCGATGGACCTTGCCGTGGCCCTGG
GATACCGGAAAGTGCAACAGGTGATCGAGAACCACATCCTCAAGCTCTTCCAGAGCAACCTGGTGCCCGC
TGACCCTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220744 protein sequence
Red=Cloning site Green=Tags(s)

MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHS
TTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETV
RFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALL
ARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003721
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003721.4
RefSeq Size 1455 bp
RefSeq ORF 783 bp
Locus ID 8625
UniProt ID O14593
Cytogenetics 19p13.11
Domains ANK
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Antigen processing and presentation, Primary immunodeficiency
MW 28.1 kDa
Summary Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC220744L1 Lenti ORF clone of Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220744L2 Lenti ORF clone of Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1, mGFP tagged 10 ug
$600.00
RC220744L3 Lenti ORF clone of Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220744L4 Lenti ORF clone of Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1, mGFP tagged 10 ug
$600.00
RG220744 RFXANK (tGFP-tagged) - Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111713 RFXANK (untagged)-Human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.