DGAT1 (NM_012079) Human Tagged ORF Clone

CAT#: RC220595

  • TrueORF®

DGAT1 (Myc-DDK-tagged)-Human diacylglycerol O-acyltransferase 1 (DGAT1)

 Cited in 2 publications.

  View "NM_012079" in other vectors (10)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DGAT1 (NM_012079) Human Tagged ORF Clone
Symbol DGAT1
Synonyms ARAT; ARGP1; DGAT; DIAR7
Vector pCMV6-Entry
Sequence Data
>RC220595 representing NM_012079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGACCGCGGCAGCTCCCGGCGCCGGAGGACAGGGTCGCGGCCCTCGAGCCACGGCGGCGGCGGGC
CTGCGGCGGCGGAAGAGGAGGTGCGGGACGCCGCTGCGGGCCCCGACGTGGGAGCCGCGGGGGACGCGCC
AGCCCCGGCCCCCAACAAGGACGGAGACGCCGGCGTGGGCAGCGGCCACTGGGAGCTGAGGTGCCATCGC
CTGCAGGATTCTTTATTCAGCTCTGACAGTGGCTTCAGCAACTACCGTGGCATCCTGAACTGGTGTGTGG
TGATGCTGATCTTGAGCAATGCCCGGTTATTTCTGGAGAACCTCATCAAGTATGGCATCCTGGTGGACCC
CATCCAGGTGGTTTCTCTGTTCCTGAAGGATCCCTATAGCTGGCCCGCCCCATGCCTGGTTATTGCGGCC
AATGTCTTTGCTGTGGCTGCATTCCAGGTTGAGAAGCGCCTGGCGGTGGGTGCCCTGACGGAGCAGGCGG
GACTGCTGCTGCACGTGGCCAACCTGGCCACCATTCTGTGTTTCCCAGCGGCTGTGGTCTTACTGGTTGA
GTCTATCACTCCAGTGGGCTCCCTGCTGGCGCTGATGGCGCACACCATCCTCTTCCTCAAGCTCTTCTCC
TACCGCGACGTCAACTCATGGTGCCGCAGGGCCAGGGCCAAGGCTGCCTCTGCAGGGAAGAAGGCCAGCA
GTGCTGCTGCCCCGCACACCGTGAGCTACCCGGACAATCTGACCTACCGCGATCTCTACTACTTCCTCTT
CGCCCCCACCTTGTGCTACGAGCTCAACTTTCCCCGCTCTCCCCGCATCCGGAAGCGCTTTCTGCTGCGA
CGGATCCTTGAGATGCTGTTCTTCACCCAGCTCCAGGTGGGGCTGATCCAGCAGTGGATGGTCCCCACCA
TCCAGAACTCCATGAAGCCCTTCAAGGACATGGACTACTCACGCATCATCGAGCGCCTCCTGAAGCTGGC
GGTCCCCAATCACCTCATCTGGCTCATCTTCTTCTACTGGCTCTTCCACTCCTGCCTGAATGCCGTGGCT
GAGCTCATGCAGTTTGGAGACCGGGAGTTCTACCGGGACTGGTGGAACTCCGAGTCTGTCACCTACTTCT
GGCAGAACTGGAACATCCCTGTGCACAAGTGGTGCATCAGACACTTCTACAAGCCCATGCTTCGACGGGG
CAGCAGCAAGTGGATGGCCAGGACAGGGGTGTTCCTGGCCTCGGCCTTCTTCCACGAGTACCTGGTGAGC
GTCCCTCTGCGAATGTTCCGCCTCTGGGCGTTCACGGGCATGATGGCTCAGATCCCACTGGCCTGGTTCG
TGGGCCGCTTTTTCCAGGGCAACTATGGCAACGCAGCTGTGTGGCTGTCGCTCATCATCGGACAGCCAAT
AGCCGTTCTCATGTACGTCCACGACTACTACGTGCTCAACTATGAGGCCCCAGCGGCAGAGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220595 representing NM_012079
Red=Cloning site Green=Tags(s)

MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHR
LQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAA
NVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFS
YRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLR
RILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVA
ELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012079
ORF Size 1464 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012079.1, NM_012079.2, NM_012079.3, NM_012079.4, NM_012079.5, NP_036211
RefSeq Size 1976
RefSeq ORF 1467
Locus ID 8694
Cytogenetics 8q24.3
Domains MBOAT
Protein Families Transmembrane
Protein Pathways Glycerolipid metabolism, Retinol metabolism, Metabolic pathways
MW 55.1 kDa
Gene Summary This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases. [provided by RefSeq, Jul 2013].

Citations (2)

Other Versions

Other products for "DGAT1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies