DPH5 (NM_015958) Human Tagged ORF Clone

SKU
RC220529
DPH5 (Myc-DDK-tagged)-Human DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DPH5
Synonyms AD-018; CGI-30; HSPC143; NPD015
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220529 representing NM_015958
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTTATCTCATCGGGTTGGGCCTGGGAGATGCCAAGGACATCACAGTCAAGGGCCTGGAAGTTGTTA
GACGCTGCAGTCGAGTGTATCTGGAAGCCTACACCTCAGTCCTAACTGTAGGGAAGGAAGCCTTGGAAGA
GTTTTATGGAAGAAAATTGGTTGTTGCTGATAGAGAAGAAGTGGAACAAGAAGCAGATAATATTTTAAAG
GATGCTGATATCAGTGATGTTGCATTCCTTGTGGTTGGTGATCCATTTGGGGCCACAACACACAGTGATC
TTGTTCTAAGAGCAACAAAGCTGGGAATTCCTTATAGAGTTATTCACAATGCCTCCATAATGAATGCTGT
AGGCTGCTGTGGTTTACAGTTATATAAGTTTGGAGAGACAGTTTCTATTGTTTTTTGGACAGACACTTGG
AGACCAGAAAGCTTCTTTGACAAAGTGAAGAAGAACAGACAAAATGGCATGCACACATTATGTTTACTAG
ACATCAAAGTAAAGGAGCAGTCTTTGGAAAATCTAATCAAGGGAAGGAAGATCTATGAACCTCCACGGTA
TATGAGTGTAAACCAAGCAGCCCAGCAGCTTCTGGAGATTGTTCAAAATCAAAGAATACGAGGAGAAGAA
CCAGCAGTTACCGAGGAGACACTTTGTGTTGGCTTAGCCAGGGTTGGAGCCGACGACCAGAAAATTGCAG
CAGGCACTTTAAGGCAAATGTGCACTGTGGACTTGGGAGAACCATTGCATTCCTTGATCATCACAGGAGG
CAGCATACATCCAATGGAGATGGAGATGCTAAGTCTGTTTTCCATACCAGAAAATAGCTCAGAATCTCAA
AGCATCAATGGACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220529 representing NM_015958
Red=Cloning site Green=Tags(s)

MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREEVEQEADNILK
DADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTW
RPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEE
PAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQ
SINGL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015958
ORF Size 855 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015958.3
RefSeq Size 1457 bp
RefSeq ORF 858 bp
Locus ID 51611
UniProt ID Q9H2P9
Cytogenetics 1p21.2
Domains TP_methylase
MW 31.5 kDa
Summary This gene encodes a component of the diphthamide synthesis pathway. Diphthamide is a post-translationally modified histidine residue found only on translation elongation factor 2. It is conserved from archaebacteria to humans, and is targeted by diphtheria toxin and Pseudomonas exotoxin A to halt cellular protein synthesis. The yeast and Chinese hamster homologs of this protein catalyze the trimethylation of the histidine residue on elongation factor 2, resulting in a diphthine moiety that is subsequently amidated to yield diphthamide. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DPH5 (NM_015958) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220529L3 Lenti ORF clone of Human DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC220529L4 Lenti ORF clone of Human DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2, mGFP tagged 10 ug
$750.00
RG220529 DPH5 (tGFP-tagged) - Human DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2 10 ug
$650.00
SC310559 DPH5 (untagged)-Human DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2 10 ug
$480.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.