FOXD1 (NM_004472) Human Tagged ORF Clone

CAT#: RC220504

FOXD1 (Myc-DDK-tagged)-Human forkhead box D1 (FOXD1)

Change vector?

  • TrueORF®

USD 598


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FOXD1 (NM_004472) Human Tagged ORF Clone
Symbol FOXD1
Synonyms FKHL8; FREAC-4; FREAC4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC220504 representing NM_004472
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCTGAGCACTGAGATGTCCGATGCCTCTGGCCTCGCCGAGGAAACAGACATCGACGTGGTGGGGG
AGGGCGAGGACGAAGAAGACGAGGAAGAGGAGGACGACGACGAGGGCGGCGGTGGCGGGCCCCGGCTGGC
TGTCCCCGCGCAGCGGCGGCGGCGGCGGCGCTCGTACGCCGGGGAGGACGAGCTGGAGGATCTGGAGGAG
GAGGAGGACGACGATGACATCCTGCTGGCCCCGCCTGCTGGGGGCTCCCCGGCGCCCCCGGGCCCGGCCC
CGGCGGCGGGGGCAGGAGCCGGTGGGGGCGGCGGCGGCGGCGGCGCGGGCGGCGGCGGGAGCGCGGGTAG
CGGCGCCAAGAACCCGCTGGTGAAGCCGCCCTACTCGTATATCGCGCTCATCACTATGGCCATCCTGCAG
AGCCCCAAGAAGCGGCTGACGCTGAGCGAGATCTGTGAGTTCATCAGCGGCCGCTTCCCCTACTACCGGG
AGAAGTTCCCCGCCTGGCAGAACAGCATCCGCCACAACCTCTCGCTCAACGACTGCTTCGTCAAGATCCC
CCGCGAGCCCGGCAACCCGGGCAAGGGCAACTACTGGACGCTGGACCCGGAGTCCGCCGACATGTTCGAC
AACGGCAGCTTCCTGCGCCGGAGGAAGCGCTTCAAGCGGCAGCCGCTGCTCCCACCCAACGCCGCGGCCG
CCGAGTCTCTGCTGCTGCGCGGCGCGGGAGCCGCAGGGGGCGCGGGCGACCCGGCAGCCGCCGCCGCGCT
CTTCCCGCCCGCGCCCCCGCCGCCCCCGCATGCCTACGGCTACGGCCCCTACGGCTGCGGCTACGGCCTG
CAGCTGCCGCCTTACGCGCCGCCCTCGGCCCTCTTCGCCGCCGCAGCGGCCGCCGCCGCCGCCGCCGCCT
TCCACCCGCACTCGCCCCCGCCGCCCCCGCCACCGCACGGCGCGGCCGCCGAGCTGGCCCGGACCGCCTT
CGGCTACCGGCCGCACCCGCTCGGCGCCGCCCTACCCGGCCCCCTGCCGGCCTCCGCGGCCAAGGCGGGC
GGCCCGGGCGCCTCAGCGCTGGCGCGCTCGCCCTTCTCCATCGAGAGCATCATCGGGGGCAGCTTGGGCC
CGGCCGCCGCTGCCGCCGCCGCCGCGCAGGCCGCCGCCGCCGCTCAGGCCTCGCCCTCGCCCTCGCCGGT
GGCGGCGCCGCCAGCTCCCGGATCCAGCGGAGGAGGCTGCGCGGCGCAGGCGGCCGTGGGCCCGGCGGCC
GCGCTCACCCGATCCCTCGTGGCCGCCGCGGCCGCCGCCGCCTCCTCAGTCTCCTCGTCCGCCGCCTTGG
GGACTCTGCACCAAGGGACTGCCCTGTCCAGTGTCGAGAACTTTACTGCTAGGATTTCCAATTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220504 representing NM_004472
Red=Cloning site Green=Tags(s)

MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEE
EEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQ
SPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFD
NGSFLRRRKRFKRQPLLPPNAAAAESLLLRGAGAAGGAGDPAAAAALFPPAPPPPPHAYGYGPYGCGYGL
QLPPYAPPSALFAAAAAAAAAAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAAKAG
GPGASALARSPFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPAA
ALTRSLVAAAAAAASSVSSSAALGTLHQGTALSSVENFTARISNC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004472
ORF Size 1395 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004472.1, NM_004472.2, NP_004463
RefSeq Size 2272
RefSeq ORF 1398
Locus ID 2297
Cytogenetics 5q13.2
Protein Families Transcription Factors
MW 46 kDa
Gene Summary This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. Studies of the orthologous mouse protein indicate that it functions in kidney development by promoting nephron progenitor differentiation, and it also functions in the development of the retina and optic chiasm. It may also regulate inflammatory reactions and prevent autoimmunity. [provided by RefSeq, Apr 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations