Integrin beta 4 binding protein (EIF6) (NM_181468) Human Tagged ORF Clone

SKU
RC220391
EIF6 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Integrin beta 4 binding protein
Synonyms b(2)gcn; CAB; eIF-6; EIF3A; ITGB4BP; p27(BBP); p27BBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220391 representing NM_181468
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTCCGAGCTTCGTTCGAGAACAACTGTGAGATCGGCTGCTTTGCCAAGCTCACCAACACCTACT
GTCTGGTAGCGATCGGAGGCTCAGAGAACTTCTACAGTGTGTTCGAGGGCGAGCTCTCCGATACCATCCC
CGTGGTGCACGCGTCTATCGCCGGCTGCCGCATCATCGGGCGCATGTGTGTGGGGAACAGGCACGGTCTC
CTGGTACCCAACAATACCACCGACCAGGAGCTGCAACACATTCGCAACAGCCTCCCAGACACAGTGCAGA
TTAGGCGGGTGGAGGAGCGGCTCTCAGCCTTGGGCAATGTCACCACCTGCAATGACTACGTGGCCTTGGT
CCACCCAGACTTGGACAGGGAGACAGAAGAAATTCTGGCAGATGTGCTCAAGGTGGAAGTCTTCAGACAG
ACAGTGGCCGACCAGGTGCTAGTAGGAAGCTACTGTGTCTTCAGCAATCAGGGAGGGCTGGTGCATCCCA
AGACTTCAATTGAAGACCAGGATGAGCTGTCCTCTCTTCTTCAAGTCCCCCTTGTGGCGGGGACTGTGAA
CCGAGGCAGTGAGGTGATTGCTGCTGGGATGGTGGTGAATGACTGGTGTGCCTTCTGTGGCCTGGACACA
ACCAGCACAGAGCTGTCAGTGGTGGAGAGTGTCTTCAAGCTGAATGAAGCCCAGCCTAGCACCATTGCCA
CCAGCATGCGGGATTCCCTCATTGACAGCCTCACC


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220391 representing NM_181468
Red=Cloning site Green=Tags(s)

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGL
LVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ
TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT
TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

TRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-NotI Cloning Scheme for this gene Plasmid Map
ACCN NM_181468
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181468.2
RefSeq Size 1259 bp
RefSeq ORF 738 bp
Locus ID 3692
UniProt ID P56537
Cytogenetics 20q11.22
Protein Families Druggable Genome
MW 26.4 kDa
Summary Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:Integrin beta 4 binding protein (EIF6) (NM_181468) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220391L1 Lenti ORF clone of Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC220391L2 Lenti ORF clone of Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2, mGFP tagged 10 ug
$600.00
RC220391L3 Lenti ORF clone of Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC220391L4 Lenti ORF clone of Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2, mGFP tagged 10 ug
$600.00
RG220391 EIF6 (tGFP-tagged) - Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2 10 ug
$500.00
SC124305 EIF6 (untagged)-Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.