TIAM1 (NM_003253) Human Tagged ORF Clone

CAT#: RC220233

Reviews ()
Write a review

TIAM1 (Myc-DDK-tagged)-Human T-cell lymphoma invasion and metastasis 1 (TIAM1)



  "NM_003253" in other vectors (6)

Reconstitution Protocol

USD 1,361.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TIAM1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TIAM1
Synonyms TIAM-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220233 representing NM_003253
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAAACGCAGAAAGTCAACATGTAGAGCACGAGTTTTATGGAGAAAAGCATGCCAGCCTGGGGCGCA
AGCACACTTCCCGCTCCCTGCGCCTCTCGCACAAGACGCGGAGGACCAGGCACGCTTCCTCGGGGAAGGT
GATCCACAGGAACTCCGAAGTGAGCACCCGATCCAGCAGCACCCCCAGCATCCCCCAGTCCCTGGCTGAA
AATGGCCTGGAGCCCTTCTCCCAAGATGGTACCCTAGAAGACTTCGGGAGCCCCATCTGGGTGGACCGAG
TGGACATGGGCTTGAGACCTGTGTCTTACACTGACTCTTCTGTCACTCCCAGCGTAGACAGCAGCATCGT
CCTCACAGCAGCCTCTGTGCAGAGCATGCCAGACACTGAGGAGAGCAGGCTTTACGGGGATGACGCTACA
TATTTGGCTGAGGGAGGCAGGAGGCAGCATTCCTATACATCCAATGGGCCCACTTTCATGGAGACGGCGA
GCTTTAAGAAGAAACGCTCCAAATCTGCAGACATCTGGCGGGAGGACAGCCTGGAATTCTCACTCTCTGA
TCTGAGCCAAGAACATTTAACAAGCAACGAAGAAATCTTGGGTTCCGCCGAAGAGAAGGACTGCGAGGAG
GCTCGGGGGATGGAAACGCGGGCGAGTCCGCGGCAGCTCAGCACCTGTCAGAGAGCCAATTCCTTGGGTG
ACTTGTATGCTCAGAAAAACTCTGGAGTGACAGCAAACGGGGGGCCGGGGAGCAAATTTGCAGGCTACTG
TCGGAATTTGGTGTCTGATATTCCCAATCTTGCAAACCATAAGATGCCACCAGCTGCTGCTGAAGAGACT
CCTCCGTACAGTAATTATAACACACTTCCCTGTAGGAAATCTCACTGTCTCTCTGAAGGTGCCACCAACC
CACAAATTAGCCATAGCAACAGCATGCAAGGCAGAAGAGCTAAAACAACTCAGGATGTTAATGCAGGCGA
GGGCAGTGAGTTTGCAGACAGTGGGATTGAAGGGGCCACTACCGACACGGACCTCCTGTCCAGGCGATCT
AATGCCACCAACTCCAGCTACTCACCCACCACAGGCCGGGCCTTTGTGGGCAGCGACAGCGGCAGCAGCT
CCACCGGGGATGCGGCTCGTCAGGGGGTGTACGAGAACTTCCGGCGGGAGCTGGAGATGAGCACCACCAA
CAGCGAGAGCCTGGAGGAGGCCGGCTCGGCGCACAGCGATGAGCAGAGCAGCGGCACCCTGAGCTCTCCG
GGCCAGTCGGACATCCTGCTGACCGCCGCACAGGGCACGGTGCGCAAGGCCGGCGCCCTGGCCGTCAAGA
ACTTCCTGGTGCACAAGAAGAACAAGAAGGTGGAGTCAGCCACCCGGAGGAAGTGGAAGCACTACTGGGT
GTCCCTGAAAGGATGCACGCTATTTTTCTACGAGAGCGACGGCAGGTCTGGGATAGACCACAACAGCATC
CCCAAACACGCCGTCTGGGTGGAGAACAGCATTGTGCAGGCGGTGCCTGAGCACCCCAAGAAGGACTTTG
TCTTCTGCCTCAGCAATTCCCTGGGTGATGCCTTCCTTTTTCAGACCACTAGCCAGACGGAGCTTGAAAA
CTGGATCACCGCCATCCACTCTGCCTGCGCCACTGCGGTCGCGAGGCACCACCACAAGGAAGACACGCTC
CGACTCCTGAAATCAGAGATCAAAAAACTGGAACAGAAGATTGACATGGATGAAAAGATGAAGAAAATGG
GTGAAATGCAGCTGTCTTCAGTCACTGACTCAAAGAAAAAGAAAACAATATTAGATCAGATCTTTGTCTG
GGAGCAAAATCTCGAGCAGTTCCAAATGGACCTGTTTCGTTTCCGCTGTTATTTAGCCAGCCTTCAGGGT
GGGGAGCTGCCAAACCCCAAAAGGCTTCTCGCTTTTGCAAGTCGACCAACGAAAGTGGCCATGGGCCGCC
TTGGAATCTTTTCGGTATCATCGTTTCATGCCCTGGTGGCAGCACGCACTGGTGAAACTGGAGTGAGAAG
ACGTACTCAGGCCATGTCCAGATCCGCGAGCAAGCGAAGGAGCAGGTTTTCTTCTCTGTGGGGTCTGGAT
ACTACCTCCAAAAAGAAGCAGGGACGGCCAAGCATCAATCAGGTGTTTGGAGAGGGAACCGAAGCTGTAA
AGAAATCTTTAGAGGGAATATTTGATGACATTGTTCCAGATGGCAAGAGGGAGAAAGAAGTGGTCTTACC
TAACGTTCACCAGCACAACCCTGACTGCGACATTTGGGTCCACGAGTATTTCACTCCATCCTGGTTCTGT
CTGCCCAATAATCAGCCTGCCCTGACGGTCGTCCGGCCAGGCGACACTGCACGGGACACCCTGGAGCTGA
TTTGCAAGACACATCAACTGGATCATTCTGCTCATTACCTGCGCCTGAAATTTCTAATAGAAAACAAAAT
GCAGCTCTATGTTCCACAGCCCGAGGAAGACATCTATGAGCTGCTGTACAAAGAAATTGAAATCTGTCCA
AAAGTCACTCAGAGCATCCACATTGAGAAGTCAGATACAGCTGCTGATACTTACGGGTTTTCACTTTCTT
CTGTGGAAGAAGATGGTATTCGAAGGCTGTACGTGAATAGTGTGAAGGAAACCGGTTTAGCTTCCAAGAA
AGGCCTGAAAGCAGGAGATGAGATTCTTGAGATCAATAATCGTGCTGCTGACGCCCTGAACTCTTCTATG
CTCAAAGATTTCCTCTCACAGCCCTCGCTGGGCCTCCTGGTGAGGACCTACCCCGAGCTGGAGGAAGGAG
TGGAGCTGCTGGAAAGCCCGCCCCACCGAGTGGACGGCCCTGCCGACCTTGGCGAGAGCCCCCTCGCCTT
TCTCACCAGCAACCCAGGGCACAGCCTTTGCAGCGAGCAGGGCAGCAGTGCTGAGACCGCTCCAGAGGAG
ACCGAGGGGCCAGACTTGGAATCCTCAGATGAGACTGATCACAGCAGCAAGAGTACAGAACAGGTGGCCG
CATTTTGCCGCAGTTTGCATGAGATGAACCCCTCTGACCAGAGCCCATCTCCTCAGGACTCCACGGGGCC
TCAGCTGGCGACCATGAGACAACTCTCGGATGCAGATAAGCTGCGCAAGGTGATCTGCGAGCTCCTGGAG
ACGGAGCGCACCTACGTGAAGGATTTAAACTGTCTTATGGAGAGATACCTAAAGCCTCTTCAAAAAGAAA
CTTTTCTCACCCAGGATGAGCTTGACGTGCTTTTTGGAAATTTAACGGAAATGGTAGAGTTTCAAGTAGA
ATTCCTTAAAACTCTAGAAGATGGAGTGAGACTGGTACCTGATTTGGAAAAGCTTGAGAAGGTTGATCAA
TTTAAGAAAGTGCTGTTCTCTCTGGGGGGATCATTCCTGTATTATGCTGACCGCTTCAAGCTCTACAGTG
CCTTCTGCGCCAGCCACACAAAAGTTCCCAAGGTCCTGGTGAAAGCCAAGACAGACACGGCTTTCAAGGC
ATTCTTGGATGCCCAGAACCCGAAGCAGCAGCACTCATCCACGCTGGAGTCGTACCTCATCAAGCCCATC
CAGAGGATCCTCAAGTACCCACTTCTGCTCAGGGAGCTGTTCGCCCTGACCGATGCGGAGAGCGAGGAGC
ACTACCACCTGGACGTGGCCATCAAGACCATGAACAAGGTTGCCAGTCACATCAATGAGATGCAGAAAAT
CCATGAAGAGTTTGGGGCTGTGTTTGACCAGCTGATTGCTGAACAGACTGGTGAGAAAAAAGAGGTTGCA
GATCTGAGCATGGGAGACCTGCTTTTGCACACTACCGTGATCTGGCTGAACCCGCCGGCCTCGCTGGGCA
AGTGGAAAAAGGAACCAGAGTTGGCAGCATTCGTCTTCAAAACTGCTGTGGTCCTTGTGTATAAAGATGG
TTCCAAACAGAAGAAGAAACTTGTAGGATCTCACAGGCTTTCCATTTATGAGGACTGGGACCCCTTCAGA
TTTCGACACATGATCCCCACGGAAGCGCTGCAGGTTCGAGCTTTGGCGAGTGCAGATGCAGAGGCAAATG
CCGTGTGTGAAATTGTCCATGTAAAATCCGAGTCTGAAGGGAGGCCGGAGAGGGTCTTTCACTTGTGCTG
CAGCTCCCCAGAGAGCCGAAAGGATTTCCTAAAGGCTGTGCATTCAATCCTGCGTGATAAGCACAGAAGA
CAGCTCCTCAAAACCGAGAGCCTTCCCTCATCCCAGCAATATGTCCCTTTTGGAGGCAAAAGATTGTGTG
CACTGAAGGGGGCCAGGCCGGCCATGAGCAGGGCAGTGTCTGCCCCAAGCAAGTCTCTTGGGAGGAGGAG
GCGGCGGCTGGCTCGAAACAGGTTTACCATTGATTCTGATGCCGTCTCCGCAAGCAGCCCGGAGAAAGAG
TCCCAGCAGCCCCCCGGTGGTGGGGACACTGACCGATGGGTAGAGGAGCAGTTTGATCTTGCTCAGTATG
AGGAGCAAGATGACATCAAGGAGACAGACATCCTCAGTGACGATGATGAGTTCTGTGAGTCCGTGAAGGG
TGCCTCAGTGGACAGAGACCTGCAGGAGCGGCTTCAGGCCACCTCCATCAGTCAGCGGGAAAGAGGCCGG
AAAACCCTGGATAGTCACGCGTCCCGCATGGCACAGCTCAAGAAGCAAGCTGCCCTGTCGGGGATCAATG
GAGGCCTGGAGAGCGCAAGCGAGGAAGTCATTTGGGTTAGGCGTGAAGACTTTGCCCCCTCCAGGAAACT
GAACACTGAGATC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC220233 representing NM_003253
Red=Cloning site Green=Tags(s)

MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSSTPSIPQSLAE
NGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTAASVQSMPDTEESRLYGDDAT
YLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDSLEFSLSDLSQEHLTSNEEILGSAEEKDCEE
ARGMETRASPRQLSTCQRANSLGDLYAQKNSGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEET
PPYSNYNTLPCRKSHCLSEGATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRS
NATNSSYSPTTGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGIDHNSI
PKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSACATAVARHHHKEDTL
RLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTILDQIFVWEQNLEQFQMDLFRFRCYLASLQG
GELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLD
TTSKKKQGRPSINQVFGEGTEAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFC
LPNNQPALTVVRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSM
LKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEE
TEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPSPQDSTGPQLATMRQLSDADKLRKVICELLE
TERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQ
FKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPI
QRILKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEDWDPFR
FRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKAVHSILRDKHRR
QLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPSKSLGRRRRRLARNRFTIDSDAVSASSPEKE
SQQPPGGGDTDRWVEEQFDLAQYEEQDDIKETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGR
KTLDSHASRMAQLKKQAALSGINGGLESASEEVIWVRREDFAPSRKLNTEI

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003253
ORF Size 4773 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003253.3
RefSeq Size 5521 bp
RefSeq ORF 4776 bp
Locus ID 7074
UniProt ID Q13009
Cytogenetics 21q22.11
Domains RhoGEF, PDZ, PH, RBD
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Regulation of actin cytoskeleton
MW 177.3 kDa
Gene Summary This gene encodes a RAC1-specific guanine nucleotide exchange factor (GEF). GEFs mediate the exchange of guanosine diphosphate (GDP) for guanosine triphosphate (GTP). The binding of GTP induces a conformational change in RAC1 that allows downstream effectors to bind and transduce a signal. This gene thus regulates RAC1 signaling pathways that affect cell shape, migration, adhesion, growth, survival, and polarity, as well as influencing actin cytoskeletal formation, endocytosis, and membrane trafficking. This gene thus plays an important role in cell invasion, metastasis, and carcinogenesis. In addition to RAC1, the encoded protein activates additional Rho-like GTPases such as CDC42, RAC2, RAC3 and RHOA. This gene encodes multiple protein isoforms that experience a diverse array of intramolecular, protein-protein, and phosphorylation interactions as well as phosphoinositide binding. Both the longer and shorter isoforms have C-terminal Dbl homology (DH) and pleckstrin homology (PH) domains while only the longer isoforms of this gene have the N-terminal myristoylation site and the downstream N-terminal PH domain, ras-binding domain (RBD), and PSD-95/DlgA/ZO-1 (PDZ) domain. [provided by RefSeq, Jul 2017]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.