Repulsive Guidance Molecule C (HFE2) (NM_145277) Human Tagged ORF Clone

SKU
RC220228
HFE2 (Myc-DDK-tagged)-Human hemochromatosis type 2 (juvenile) (HFE2), transcript variant b
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Repulsive Guidance Molecule C
Synonyms HFE2; HFE2A; JH; RGMC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220228 representing NM_145277
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCAGCACAACTGCTCCCGCCAGGGCCCTACAGCCCCTCCCCCGCCCCGGGGCCCCGCCCTTCCAG
GCGCGGGCTCCGGCCTCCCTGCCCCGGACCCTTGTGACTATGAAGGCCGGTTTTCCCGGCTGCATGGTCG
TCCCCCGGGGTTCTTGCATTGCGCTTCCTTCGGGGACCCCCATGTGCGCAGCTTCCACCATCACTTTCAC
ACATGCCGTGTCCAAGGAGCTTGGCCTCTACTGGATAATGACTTCCTCTTTGTCCAAGCCACCAGCTCCC
CCATGGCGTTGGGGGCCAACGCTACCGCCACCCGGAAGCTCACCATCATATTTAAGAACATGCAGGAATG
CATTGATCAGAAGGTGTATCAGGCTGAGGTGGATAATCTTCCTGTAGCCTTTGAAGATGGTTCTATCAAT
GGAGGTGACCGACCTGGGGGATCCAGTTTGTCGATTCAAACTGCTAACCCTGGGAACCATGTGGAGATCC
AAGCTGCCTACATTGGCACAACTATAATCATTCGGCAGACAGCTGGGCAGCTCTCCTTCTCCATCAAGGT
AGCAGAGGATGTGGCCATGGCCTTCTCAGCTGAACAGGACCTGCAGCTCTGTGTTGGGGGGTGCCCTCCA
AGTCAGCGACTCTCTCGATCAGAGCGCAATCGTCGGGGAGCTATAACCATTGATACTGCCAGACGGCTGT
GCAAGGAAGGGCTTCCAGTGGAAGATGCTTACTTCCATTCCTGTGTCTTTGATGTTTTAATTTCTGGTGA
TCCCAACTTTACCGTGGCAGCTCAGGCAGCACTGGAGGATGCCCGAGCCTTCCTGCCAGACTTAGAGAAG
CTGCATCTCTTCCCCTCAGATGCTGGGGTTCCTCTTTCCTCAGCAACCCTCTTAGCTCCACTCCTTTCTG
GGCTCTTTGTTCTGTGGCTTTGCATTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220228 representing NM_145277
Red=Cloning site Green=Tags(s)

MIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFH
TCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSIN
GGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPP
SQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEK
LHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145277
ORF Size 939 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145277.5
RefSeq Size 1961 bp
RefSeq ORF 942 bp
Locus ID 148738
UniProt ID Q6ZVN8
Cytogenetics 1q21.1
Protein Families Transmembrane
MW 33.5 kDa
Summary The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Two uORFs in the 5' UTR negatively regulate the expression and activity of the encoded protein. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq, Oct 2015]
Write Your Own Review
You're reviewing:Repulsive Guidance Molecule C (HFE2) (NM_145277) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220228L3 Lenti ORF clone of Human hemochromatosis type 2 (juvenile) (HFE2), transcript variant b, Myc-DDK-tagged 10 ug
$600.00
RC220228L4 Lenti ORF clone of Human hemochromatosis type 2 (juvenile) (HFE2), transcript variant b, mGFP tagged 10 ug
$600.00
RG220228 HFE2 (tGFP-tagged) - Human hemochromatosis type 2 (juvenile) (HFE2), transcript variant b 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124916 HFE2 (untagged)-Human hemochromatosis type 2 (juvenile) (HFE2), transcript variant b 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.