Ephrin A4 (EFNA4) (NM_182690) Human Tagged ORF Clone

SKU
RC220109
EFNA4 (Myc-DDK-tagged)-Human ephrin-A4 (EFNA4), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Ephrin A4
Synonyms EFL4; EPLG4; LERK4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220109 representing NM_182690
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCTGCTGCCCCTGCTGCGGACTGTCCTCTGGGCCGCGTTCCTCGGCTCCCCTCTGCGCGGGGGCT
CCAGCCTCCGCCACGTAGTCTACTGGAACTCCAGTAACCCCAGGTTGCTTCGAGGAGACGCCGTGGTGGA
GCTGGGCCTCAACGATTACCTAGACATTGTCTGCCCCCACTACGAAGGCCCAGGGCCCCCTGAGGGCCCC
GAGACGTTTGCTTTGTACATGGTGGACTGGCCAGGCTATGAGTCCTGCCAGGCAGAGGGCCCCCGGGCCT
ACAAGCGCTGGGTGTGCTCCCTGCCCTTTGGCCATGTTCAATTCTCAGAGAAGATTCAGCGCTTCACACC
CTTCTCCCTCGGCTTTGAGTTCTTACCTGGAGAGACTTACTACTACATCTCGGTGCCCACTCCAGAGAGT
TCTGGCCAGTGCTTGAGGCTCCAGGTGTCTGTCTGCTGCAAGGAGAGGAACCTTCCCTCTCATCCCAAGG
AGCCAGAGTCCTCCCAAGATCCCCTGGAGGAGGAGGGATCCCTGCTGCCTGCACTGGGGGTGCCAATTCA
GACCGACAAGATGGAGCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220109 representing NM_182690
Red=Cloning site Green=Tags(s)

MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP
ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES
SGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_182690
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182690.3
RefSeq Size 1111 bp
RefSeq ORF 582 bp
Locus ID 1945
UniProt ID P52798
Cytogenetics 1q21.3
Protein Families Secreted Protein
Protein Pathways Axon guidance
MW 21.7 kDa
Summary This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Ephrin A4 (EFNA4) (NM_182690) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220109L1 Lenti ORF clone of Human ephrin-A4 (EFNA4), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC220109L2 Lenti ORF clone of Human ephrin-A4 (EFNA4), transcript variant 3, mGFP tagged 10 ug
$600.00
RC220109L3 Lenti ORF clone of Human ephrin-A4 (EFNA4), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC220109L4 Lenti ORF clone of Human ephrin-A4 (EFNA4), transcript variant 3, mGFP tagged 10 ug
$600.00
RG220109 EFNA4 (tGFP-tagged) - Human ephrin-A4 (EFNA4), transcript variant 3 10 ug
$500.00
SC309495 EFNA4 (untagged)-Human ephrin-A4 (EFNA4), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.