VPS24 (CHMP3) (NM_016079) Human Tagged ORF Clone

SKU
RC220006
CHMP3 (Myc-DDK-tagged)-Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol VPS24
Synonyms CGI-149; NEDF; VPS24
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220006 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGTTTGGAAAGACCCAGGAGAAGCCGCCCAAAGAACTGGTCAATGAGTGGTCATTGAAGATAA
GAAAGGAAATGAGAGTTGTTGACAGGCAAATAAGGGATATCCAAAGAGAAGAAGAAAAAGTGAAACGATC
TGTGAAAGATGCTGCCAAGAAGGGCCAGAAGGATGTCTGCATAGTTCTGGCCAAGGAGATGATCAGGTCA
AGGAAGGCTGTGAGCAAGCTGTATGCATCCAAAGCACACATGAACTCAGTGCTCATGGGGATGAAGAACC
AGCTCGCGGTCTTGCGAGTGGCTGGTTCCCTGCAGAAGAGCACAGAAGTGATGAAGGCCATGCAAAGTCT
TGTGAAGATTCCAGAGATTCAGGCCACCATGAGGGAGTTGTCCAAAGAAATGATGAAGGCTGGGATCATA
GAGGAGATGTTAGAGGACACTTTTGAAAGCATGGACGATCAGGAAGAAATGGAGGAAGAAGCAGAAATGG
AAATTGACAGAATTCTCTTTGAAATTACAGCAGGGGCCTTGGGCAAAGCACCCAGTAAAGTGACTGATGC
CCTTCCAGAGCCAGAACCTCCAGGAGCGATGGCTGCCTCAGAGGATGAGGAGGAGGAGGAAGAGGCTCTG
GAGGCCATGCAGTCCCGGCTGGCCACACTCCGCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC220006 protein sequence
Red=Cloning site Green=Tags(s)

MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS
RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII
EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL
EAMQSRLATLRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016079
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016079.4
RefSeq Size 3194 bp
RefSeq ORF 669 bp
Locus ID 51652
UniProt ID Q9Y3E7
Cytogenetics 2p11.2
Domains DUF279
Protein Pathways Endocytosis
MW 25.1 kDa
Summary This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:VPS24 (CHMP3) (NM_016079) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220006L1 Lenti ORF clone of Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220006L2 Lenti ORF clone of Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1, mGFP tagged 10 ug
$600.00
RC220006L3 Lenti ORF clone of Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220006L4 Lenti ORF clone of Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1, mGFP tagged 10 ug
$600.00
RG220006 CHMP3 (tGFP-tagged) - Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111287 CHMP3 (untagged)-Human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.