KLRG1 (NM_005810) Human Tagged ORF Clone

SKU
RC219705
KLRG1 (Myc-DDK-tagged)-Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KLRG1
Synonyms 2F1; CLEC15A; MAFA; MAFA-2F1; MAFA-L; MAFA-LIKE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219705 representing NM_005810
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGACAGTGTTATTTATTCCATGTTAGAGTTGCCTACGGCAACCCAAGCCCAGAATGACTATGGAC
CACAGCAAAAATCTTCCTCTTCCAGGCCTTCTTGTTCTTGCCTTGTGGCAATAGCTTTGGGGCTTCTGAC
TGCAGTTCTTCTGAGTGTGCTGCTATACCAGTGGATCCTGTGCCAGGGCTCCAACTACTCCACTTGTGCC
AGCTGTCCTAGCTGCCCAGACCGCTGGATGAAATATGGTAACCATTGTTATTATTTCTCAGTGGAGGAAA
AGGACTGGAATTCTAGTCTGGAATTCTGCCTAGCCAGAGACTCACACCTCCTTGTGATAACGGACAATCA
GGAAATGAGCCTGCTCCAAGTTTTCCTCAGTGAGGCCTTTTGCTGGATTGGTCTGAGGAACAATTCTGGC
TGGAGGTGGGAAGATGGATCACCTCTAAACTTCTCAAGGATTTCTTCTAATAGCTTTGTGCAGACATGCG
GTGCCATCAACAAAAATGGTCTTCAAGCCTCAAGCTGTGAAGTTCCTTTACACTGGGTGTGTAAGAAGGT
CAGACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219705 representing NM_005810
Red=Cloning site Green=Tags(s)

MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCA
SCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSG
WRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005810
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005810.4
RefSeq Size 1815 bp
RefSeq ORF 570 bp
Locus ID 10219
UniProt ID Q96E93
Cytogenetics 12p13.31
Protein Families Transmembrane
MW 21 kDa
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. [provided by RefSeq, Jun 2016]
Write Your Own Review
You're reviewing:KLRG1 (NM_005810) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219705L1 Lenti ORF clone of Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1), Myc-DDK-tagged 10 ug
$600.00
RC219705L2 Lenti ORF clone of Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1), mGFP tagged 10 ug
$600.00
RC219705L3 Lenti ORF clone of Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1), Myc-DDK-tagged 10 ug
$600.00
RC219705L4 Lenti ORF clone of Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1), mGFP tagged 10 ug
$600.00
RG219705 KLRG1 (tGFP-tagged) - Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1) 10 ug
$500.00
SC303694 KLRG1 (untagged)-Human killer cell lectin-like receptor subfamily G, member 1 (KLRG1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.