CD32B (FCGR2B) (NM_001002273) Human Tagged ORF Clone

SKU
RC219569
FCGR2B (Myc-DDK-tagged)-Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD32B
Synonyms CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219569 representing NM_001002273
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAATCCTGTCATTCTTACCTGTCCTTGCCACTGAGAGTGACTGGGCTGACTGCAAGTCCCCCCAGC
CTTGGGGTCATATGCTTCTGTGGACAGCTGTGCTATTCCTGGCTCCTGTTGCTGGGACACCTGCTCCCCC
AAAGGCTGTGCTGAAACTCGAGCCCCAGTGGATCAACGTGCTCCAGGAGGACTCTGTGACTCTGACATGC
CGGGGGACTCACAGCCCTGAGAGCGACTCCATTCAGTGGTTCCACAATGGGAATCTCATTCCCACCCACA
CGCAGCCCAGCTACAGGTTCAAGGCCAACAACAATGACAGCGGGGAGTACACGTGCCAGACTGGCCAGAC
CAGCCTCAGCGACCCTGTGCATCTGACTGTGCTTTCTGAGTGGCTGGTGCTCCAGACCCCTCACCTGGAG
TTCCAGGAGGGAGAAACCATCGTGCTGAGGTGCCACAGCTGGAAGGACAAGCCTCTGGTCAAGGTCACAT
TCTTCCAGAATGGAAAATCCAAGAAATTTTCCCGTTCGGATCCCAACTTCTCCATCCCACAAGCAAACCA
CAGTCACAGTGGTGATTACCACTGCACAGGAAACATAGGCTACACGCTGTACTCATCCAAGCCTGTGACC
ATCACTGTCCAAGCTCCCAGCTCTTCACCGATGGGGATCATTGTGGCTGTGGTCACTGGGATTGCTGTAG
CGGCCATTGTTGCTGCTGTAGTGGCCTTGATCTACTGCAGGAAAAAGCGGATTTCAGCCAATCCCACTAA
TCCTGATGAGGCTGACAAAGTTGGGGCTGAGAACACAATCACCTATTCACTTCTCATGCACCCGGATGCT
CTGGAAGAGCCTGATGACCAGAACCGTATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219569 representing NM_001002273
Red=Cloning site Green=Tags(s)

MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINVLQEDSVTLTC
RGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLE
FQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVT
ITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001002273
ORF Size 870 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001002273.2
RefSeq Size 1573 bp
RefSeq ORF 873 bp
Locus ID 2213
UniProt ID P31994
Cytogenetics 1q23.3
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus
MW 31.7 kDa
Summary The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Write Your Own Review
You're reviewing:CD32B (FCGR2B) (NM_001002273) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219569L1 Lenti ORF clone of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC219569L2 Lenti ORF clone of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, mGFP tagged 10 ug
$600.00
RC219569L3 Lenti ORF clone of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC219569L4 Lenti ORF clone of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, mGFP tagged 10 ug
$600.00
RG219569 FCGR2B (tGFP-tagged) - Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2 10 ug
$500.00
SC300432 FCGR2B (untagged)-Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.