NCKAP5L (NM_001037806) Human Tagged ORF Clone

SKU
RC219478
NCKAP5L (Myc-DDK-tagged)-Human NCK-associated protein 5-like (NCKAP5L)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NCKAP5L
Synonyms Cep169; FP1193; KIAA1602
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219478 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCAGCCAGCTGGGGGTCCTGGAAACCCAAGGCCAGGAGAGGGTGATGATGGCAGCATGGAGCCAG
GCACCTGCCAGGAGCTTCTGCACCGACTGCGGGAGCTGGAGGCAGAGAACTCGGCACTTGCCCAGGCCAA
CGAAAACCAGCGGGAGACTTATGAGCGCTGTCTGGACGAGGTCTGTGGGTCTGTAGTGGGACTGGGGGGA
TGTGGCTCATCTGCTCCTGGCAGAAGCTGGGGTCAGCTGATGGCTCTGCCTCGGGGCTTTCTGTCCCCAG
GTTGCCAACCATGTGGTACAGGCGTTGCTGAACCAGAAGGTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219478 protein sequence
Red=Cloning site Green=Tags(s)

MDQPAGGPGNPRPGEGDDGSMEPGTCQELLHRLRELEAENSALAQANENQRETYERCLDEVCGSVVGLGG
CGSSAPGRSWGQLMALPRGFLSPGCQPCGTGVAEPEGE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001037806
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001037806.2
RefSeq Size 4918 bp
RefSeq ORF 4005 bp
Locus ID 57701
UniProt ID Q9HCH0
Cytogenetics 12q13.12
MW 11.2 kDa
Summary Regulates microtubule organization and stabilization. Promotes microtubule growth and bundling formation and stabilizes microtubules by increasing intense acetylation of microtubules (PubMed:26482847, PubMed:26485573). Both tubulin-binding and homodimer formation are required for NCKAP5L-mediated microtubule bundle formation (PubMed:26485573).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NCKAP5L (NM_001037806) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219478L3 Lenti ORF clone of Human NCK-associated protein 5-like (NCKAP5L), Myc-DDK-tagged 10 ug
$450.00
RC219478L4 Lenti ORF clone of Human NCK-associated protein 5-like (NCKAP5L), mGFP tagged 10 ug
$450.00
RG219478 NCKAP5L (tGFP-tagged) - Human NCK-associated protein 5-like (NCKAP5L) 10 ug
$489.00
SC302937 NCKAP5L (untagged)-Human NCK-associated protein 5-like (NCKAP5L) 10 ug
$1,256.00
SC328065 NCKAP5L (untagged)-Human NCK-associated protein 5-like (NCKAP5L) 10 ug
$1,256.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.