FBXO44 (NM_183413) Human Tagged ORF Clone

SKU
RC219237
FBXO44 (Myc-DDK-tagged)-Human F-box protein 44 (FBXO44), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FBXO44
Synonyms FBG3; FBX6A; FBX30; Fbx44; Fbxo6a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219237 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGGGAACATCAACGAGCTGCCCGAGAACATCCTGCTGGAGCTGTTCACGCACGTGCCCGCCC
GCCAGCTGCTGCTGAACTGCCGCCTGGTCTGCAGCCTCTGGCGGGACCTCATCGACCTCGTGACCCTCTG
GAAACGCAAGTGCCTGCGAGAGGGCTTCATCACTGAGGACTGGGACCAGCCCGTGGCCGACTGGAAGATC
TTCTACTTCTTACGGAGCCTGCACAGGAACCTCCTGCACAACCCGTGCGCTGAAGAGGGGTTCGAGTTCT
GGAGCCTGGATGTGAATGGAGGCGATGAGTGGAAGGTGGAGGATCTCTCTCGAGACCAGAGGAAGGAATT
CCCCAATGACCAGGTTCGCAGCCAGGCCAGATTGCGGGTCCAAGTACCAGCTGTGCGTTCAGCTCCTGTC
GTCCGCGCACGCGCCTCTGGGGACCTTCCAGCCAGACCCGGCGACCATCCAGCAGAAGAGCGATGCCAAG
TGGAGGGAGGTCTCCCACACATTCTCCAACTACCCGCCCGGCGTCCGCTACATCTGGTTTCAGCACGGCG
GCGTGGACACTCATTACTGGGCCGGCTGGTACGGCCCGAGGGTCACCAACAGCAGCATCACCATCGGGCC
CCCGCTGCCCTGACACCCCCTGAGCCCCCATCTGCTGAACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219237 protein sequence
Red=Cloning site Green=Tags(s)

MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI
FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPV
VRARASGDLPARPGDHPAEERCQVEGGLPHILQLPARRPLHLVSARRRGHSLLGRLVRPEGHQQQHHHRA
PAALTPPEPPSAEP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_183413
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_183413.2, NP_904320.1
RefSeq Size 2823 bp
RefSeq ORF 675 bp
Locus ID 93611
UniProt ID Q9H4M3
Cytogenetics 1p36.22
Protein Families Druggable Genome
MW 25.7 kDa
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015]
Write Your Own Review
You're reviewing:FBXO44 (NM_183413) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219237L1 Lenti ORF clone of Human F-box protein 44 (FBXO44), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC219237L2 Lenti ORF clone of Human F-box protein 44 (FBXO44), transcript variant 3, mGFP tagged 10 ug
$600.00
RC219237L3 Lenti ORF clone of Human F-box protein 44 (FBXO44), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC219237L4 Lenti ORF clone of Human F-box protein 44 (FBXO44), transcript variant 3, mGFP tagged 10 ug
$600.00
RG219237 FBXO44 (tGFP-tagged) - Human F-box protein 44 (FBXO44), transcript variant 3 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC107685 FBXO44 (untagged)-Human F-box protein 44 (FBXO44), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.