ASCL4 (NM_203436) Human Tagged ORF Clone

SKU
RC218928
ASCL4 (Myc-DDK-tagged)-Human achaete-scute complex homolog 4 (Drosophila) (ASCL4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $450.00 MSRP $450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ASCL4
Synonyms ASH-4; bHLHa44; HASH4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218928 representing NM_203436
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGAGACGCGTAAACCGGCGGAACGGCTGGCCTTGCCATACTCGCTGCGCACCGCGCCCCTGGGCG
TTCCGGGGACCCTGCCCGGACTCCCGCGGAGGGACCCCCTCAGGGTCGCCCTGCGTCTGGACGCCGCGTG
CTGGGAGTGGGCGCGCAGCGGCTGCGCACGGGGATGGCAGTACTTGCCCGTGCCGCTGGACAGCGCCTTC
GAGCCCGCCTTCCTCCGCAAGCGCAACGAGCGCGAGCGGCAGCGGGTGCGCTGCGTGAACGAGGGCTATG
CGCGCCTCCGAGACCACCTGCCCCGGGAGCTGGCAGACAAGCGCCTCAGCAAAGTGGAGACGCTCCGCGC
TGCCATCGACTACATCAAGCACCTGCAGGAGCTGCTGGAGCGCCAGGCCTGGGGGCTCGAGGGCGCGGCC
GGCGCCGTCCCCCAGCGCAGGGCGGAATGCAACAGCGACGGGGAGTCCAAGGCCTCTTCGGCGCCTTCGC
CCAGCAGCGAGCCCGAGGAGGGGGGCAGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218928 representing NM_203436
Red=Cloning site Green=Tags(s)

MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAF
EPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAA
GAVPQRRAECNSDGESKASSAPSPSSEPEEGGS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_203436
ORF Size 519 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_203436.2, NP_982260.2
RefSeq Size 2260 bp
RefSeq ORF 519 bp
Locus ID 121549
UniProt ID Q6XD76
Cytogenetics 12q23.3
MW 19.4 kDa
Summary Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:ASCL4 (NM_203436) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218928L3 Lenti-ORF clone of ASCL4 (Myc-DDK-tagged)-Human achaete-scute complex homolog 4 (Drosophila) (ASCL4) 10 ug
$750.00
RC218928L4 Lenti-ORF clone of ASCL4 (mGFP-tagged)-Human achaete-scute complex homolog 4 (Drosophila) (ASCL4) 10 ug
$750.00
RG218928 ASCL4 (tGFP-tagged) - Human achaete-scute complex homolog 4 (Drosophila) (ASCL4) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC308176 ASCL4 (untagged)-Human achaete-scute complex homolog 4 (Drosophila) (ASCL4) 10 ug
$450.00
SC327747 ASCL4 (untagged)-Human achaete-scute complex homolog 4 (Drosophila) (ASCL4) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.