alpha Defensin 1 (DEFA1) (NM_004084) Human Tagged ORF Clone

SKU
RC218421
DEFA1 (Myc-DDK-tagged)-Human defensin, alpha 1 (DEFA1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol alpha Defensin 1
Synonyms DEF1; DEFA2; HNP-1; HP-1; HP1; MRS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218421 representing NM_004084
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAGCCACTCCAGG
CAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATTGCAGCGGACATCCCAGAAGTGGTTGTTTCCCT
TGCATGGGACGAAAGCTTGGCTCCAAAGCATCCAGGCTCAAGGAAAAACATGGACTGCTATTGCAGAATA
CCAGCGTGCATTGCAGGAGAACGTCGCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCT
GC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218421 representing NM_004084
Red=Cloning site Green=Tags(s)

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRI
PACIAGERRYGTCIYQGRLWAFCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004084
ORF Size 282 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004084.3
RefSeq Size 490 bp
RefSeq ORF 285 bp
Locus ID 1667
UniProt ID P59665
Cytogenetics 8p23.1
Domains defensins, Defensin_propep, DEFSN
Protein Families Druggable Genome, Secreted Protein
MW 10 kDa
Summary Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation. [provided by RefSeq, Oct 2014]
Write Your Own Review
You're reviewing:alpha Defensin 1 (DEFA1) (NM_004084) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218421L1 Lenti ORF clone of Human defensin, alpha 1 (DEFA1), Myc-DDK-tagged 10 ug
$450.00
RC218421L2 Lenti ORF clone of Human defensin, alpha 1 (DEFA1), mGFP tagged 10 ug
$450.00
RC218421L3 Lenti ORF clone of Human defensin, alpha 1 (DEFA1), Myc-DDK-tagged 10 ug
$450.00
RC218421L4 Lenti ORF clone of Human defensin, alpha 1 (DEFA1), mGFP tagged 10 ug
$450.00
RG218421 DEFA1 (tGFP-tagged) - Human defensin, alpha 1 (DEFA1) 10 ug
$489.00
SC117582 DEFA1 (untagged)-Human defensin, alpha 1 (DEFA1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.