CAMLG (NM_001745) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC218292
CAMLG (Myc-DDK-tagged)-Human calcium modulating ligand (CAMLG)
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CAMLG
Synonyms CAML; GET2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218292 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTCGATGGCCGTCGCTACCGACGGCGGGGAGAGGCCGGGGGTCCCAGCGGGCTCAGGTCTGTCGG
CTTCCCAGCGTCGGGCGGAGCTGCGTCGGAGAAAGCTGCTCATGAACTCGGAACAGCGCATCAACCGGAT
CATGGGCTTTCACAGGCCCGGGAGCGGCGCGGAAGAAGAAAGTCAAACAAAATCAAAGCAGCAGGACAGT
GATAAACTGAACTCCCTCAGCGTTCCTTCCGTTTCAAAGCGAGTAGTGCTGGGTGATTCAGTCAGTACAG
GAACAACTGACCAGCAGGGTGGTGTGGCCGAGGTAAAGGGGACCCAACTGGGAGACAAATTGGACTCGTT
CATTAAACCACCTGAGTGCAGTAGTGATGTCAACCTTGAGCTCCGGCAGCGGAACAGAGGGGACCTGACA
GCGGACTCGGTCCAGAGGGGTTCCCGCCATGGCCTAGAGCAGTACCTTTCCAGATTCGAAGAAGCAATGA
AGCTAAGGAAACAGCTGATTAGTGAAAAACCCAGTCAAGAGGATGGAAATACAACAGAAGAATTTGACTC
TTTTCGAATATTTAGATTGGTGGGATGTGCTCTTCTTGCTCTTGGAGTCAGAGCTTTTGTTTGCAAATAC
TTGTCCATATTTGCTCCATTTCTTACTTTACAACTTGCGTACATGGGATTATACAAATATTTTCCCAAGA
GTGAAAAGAAGATAAAGACAACAGTACTAACAGCTGCACTTCTATTGTCGGGAATTCCTGCCGAAGTGAT
AAATCGATCAATGGATACCTATAGCAAAATGGGCGAAGTCTTCACAGATCTCTGTGTCTACTTTTTCACT
TTTATCTTTTGTCATGAACTGCTTGATTATTGGGGCTCTGAAGTACCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218292 protein sequence
Red=Cloning site Green=Tags(s)

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS
DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT
ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY
LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT
FIFCHELLDYWGSEVP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001745
ORF Size 888 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001745.4
RefSeq Size 2255 bp
RefSeq ORF 891 bp
Locus ID 819
UniProt ID P49069
Cytogenetics 5q31.1
Protein Families Druggable Genome
MW 33 kDa
Summary The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq, Jul 2008]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC218292L1 Lenti ORF clone of Human calcium modulating ligand (CAMLG), Myc-DDK-tagged 10 ug
$600.00
RC218292L2 Lenti ORF clone of Human calcium modulating ligand (CAMLG), mGFP tagged 10 ug
$600.00
RC218292L3 Lenti ORF clone of Human calcium modulating ligand (CAMLG), Myc-DDK-tagged 10 ug
$600.00
RC218292L4 Lenti ORF clone of Human calcium modulating ligand (CAMLG), mGFP tagged 10 ug
$600.00
RG218292 CAMLG (tGFP-tagged) - Human calcium modulating ligand (CAMLG) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119078 CAMLG (untagged)-Human calcium modulating ligand (CAMLG) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.