Thymidine Kinase 1 (TK1) (NM_003258) Human Tagged ORF Clone

SKU
RC218280
TK1 (Myc-DDK-tagged)-Human thymidine kinase 1, soluble (TK1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Thymidine Kinase 1
Synonyms TK2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218280 representing NM_003258.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAGCTGCATTAACCTGCCCACTGTGCTGCCTGGCTCCCCCAGCAAGACCCGGGGGCAGATCCAGGTG
ATTCTCGGGCCGATGTTCTCAGGAAAAAGCACAGAGTTGATGAGACGCGTCCGTCGCTTCCAGATTGCT
CAGTACAAGTGCCTGGTGATCAAGTATGCCAAAGACACTCGCTACAGCAGCAGCTTCTGCACACATGAC
CGGAACACCATGGAGGCACTGCCCGCCTGCCTGCTCCGAGACGTGGCCCAGGAGGCCCTGGGCGTGGCT
GTCATAGGCATCGACGAGGGGCAGTTTTTCCCTGACATCGTGGAGTTCTGCGAGGCCATGGCCAACGCC
GGGAAGACCGTAATTGTGGCTGCACTGGATGGGACCTTCCAGAGGAAGCCATTTGGGGCCATCCTGAAC
CTGGTGCCGCTGGCCGAGAGCGTGGTGAAGCTGACGGCGGTGTGCATGGAGTGCTTCCGGGAAGCCGCC
TATACCAAGAGGCTCGGCACAGAGAAGGAGGTCGAGGTGATTGGGGGAGCAGACAAGTACCACTCCGTG
TGTCGGCTCTGCTACTTCAAGAAGGCCTCAGGCCAGCCTGCCGGGCCGGACAACAAAGAGAACTGCCCA
GTGCCAGGAAAGCCAGGGGAAGCCGTGGCTGCCAGGAAGCTCTTTGCCCCACAGCAGATTCTGCAATGC
AGCCCTGCCAAC

ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAG
GATGACGACGATAAG
GTTTAAACGGCCGGCCGCGGT
Protein Sequence
>Peptide sequence encoded by RC218280
Blue=ORF Red=Cloning site Green=Tag(s)

MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHD
RNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILN
LVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCP
VPGKPGEAVAARKLFAPQQILQCSPAN

TRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-NotI Cloning Scheme for this gene Plasmid Map
ACCN NM_003258
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003258.5
RefSeq Size 1616 bp
RefSeq ORF 705 bp
Locus ID 7083
UniProt ID P04183
Cytogenetics 17q25.3
Domains TK
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism
MW 25.5 kDa
Summary The protein encoded by this gene is a cytosolic enzyme that catalyzes the addition of a gamma-phosphate group to thymidine. This creates dTMP and is the first step in the biosynthesis of dTTP, which is one component required for DNA replication. The encoded protein, whose levels fluctuate depending on the cell cycle stage, can act as a low activity dimer or a high activity tetramer. High levels of this protein have been used as a biomarker for diagnosing and categorizing many types of cancers. [provided by RefSeq, Oct 2016]
Write Your Own Review
You're reviewing:Thymidine Kinase 1 (TK1) (NM_003258) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218280L1 Lenti ORF clone of Human thymidine kinase 1, soluble (TK1), Myc-DDK-tagged 10 ug
$600.00
RC218280L2 Lenti ORF clone of Human thymidine kinase 1, soluble (TK1), mGFP tagged 10 ug
$600.00
RC218280L3 Lenti ORF clone of Human thymidine kinase 1, soluble (TK1), Myc-DDK-tagged 10 ug
$600.00
RC218280L4 Lenti ORF clone of Human thymidine kinase 1, soluble (TK1), mGFP tagged 10 ug
$600.00
RG218280 TK1 (tGFP-tagged) - Human thymidine kinase 1, soluble (TK1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118084 TK1 (untagged)-Human thymidine kinase 1, soluble (TK1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.