RGS1 (NM_002922) Human Tagged ORF Clone

SKU
RC218112
RGS1 (Myc-DDK-tagged)-Human regulator of G-protein signaling 1 (RGS1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $450.00 MSRP $450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RGS1
Synonyms 1R20; BL34; HEL-S-87; IER1; IR20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218112 representing NM_002922
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCGCAGCAGCCATCTCCACTCCAAAGTTAGACAAAATGCCAGGAATGTTCTTCTCTGCTAACCCAA
AGGAATTGAAAGGAACCACTCATTCACTTCTAGACGACAAAATGCAAAAAAGGAGGCCAAAGACTTTTGG
AATGGATATGAAAGCATACCTGAGATCTATGATCCCACATCTGGAATCTGGAATGAAATCTTCCAAGTCC
AAGGATGTACTTTCTGCTGCTGAAGTAATGCAATGGTCTCAATCTCTGGAAAAACTTCTTGCCAACCAAA
CTGGTCAAAATGTCTTTGGAAGTTTCCTAAAGTCTGAATTCAGTGAGGAGAATATTGAGTTCTGGCTGGC
TTGTGAAGACTATAAGAAAACAGAGTCTGATCTTTTGCCCTGTAAAGCAGAAGAGATATATAAAGCATTT
GTGCATTCAGATGCTGCTAAACAAATCAATATTGACTTCCGCACTCGAGAATCTACAGCCAAGAAGATTA
AAGCACCAACCCCCACGTGTTTTGATGAAGCACAAAAAGTCATATATACTCTTATGGAAAAGGACTCTTA
TCCCAGGTTCCTCAAATCAGATATTTACTTAAATCTTCTAAATGACCTGCAGGCTAATAGCCTAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC218112 representing NM_002922
Red=Cloning site Green=Tags(s)

MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKS
KDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002922
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002922.4
RefSeq Size 1403 bp
RefSeq ORF 630 bp
Locus ID 5996
UniProt ID Q08116
Cytogenetics 1q31.2
Domains RGS
MW 23.7 kDa
Summary This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RGS1 (NM_002922) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218112L1 Lenti-ORF clone of RGS1 (Myc-DDK-tagged)-Human regulator of G-protein signaling 1 (RGS1) 10 ug
$750.00
RC218112L2 Lenti-ORF clone of RGS1 (mGFP-tagged)-Human regulator of G-protein signaling 1 (RGS1) 10 ug
$750.00
RC218112L3 Lenti-ORF clone of RGS1 (Myc-DDK-tagged)-Human regulator of G-protein signaling 1 (RGS1) 10 ug
$750.00
RC218112L4 Lenti-ORF clone of RGS1 (mGFP-tagged)-Human regulator of G-protein signaling 1 (RGS1) 10 ug
$750.00
RG218112 RGS1 (tGFP-tagged) - Human regulator of G-protein signaling 1 (RGS1) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC123871 RGS1 (untagged)-Human regulator of G-protein signaling 1 (RGS1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.