Myosin Phosphatase 2 (PPP1R12B) (NM_032104) Human Tagged ORF Clone

SKU
RC217905
PPP1R12B (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Myosin Phosphatase 2
Synonyms MYPT2; PP1bp55
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217905 representing NM_032104
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAAAAATGAGAATGAAGAAGCAGATTTGGATGAGCAGTCCTCTAAGAGGCTGTCCATCCGAGAGA
GGAGGCGGCCCAAGGAACGACGAAGAGGCACAGGCATCAATTTCTGGACAAAGGATGAGGATGAAACTGA
TGGCTCTGAAGAGGTCAAAGAAACGTGGCATGAAAGACTTTCTAGGTTGGAATCGGGAGGTAGTAATCCT
ACAACCAGTGATTCTTACGGTGACCGGGCTTCAGCAAGAGCCCGTCGGGAGGCCCGGGAGGCCCGCCTAG
CCACCCTGACCAGCCGTGTAGAAGAAGACAGCAACAGAGATTATAAAAAACTCTATGAGAGTGCTCTGAC
TGAAAACCAAAAACTGAAAACAAAACTTCAGGAAGCCCAGCTAGAGCTAGCAGATATAAAGTCCAAGCTT
GAGAAGGTGGCCCAGCAGAAACAAGAAAAGACCTCTGACCGATCATCAGTGCTGGAGATGGAGAAACGGG
AGAGGCGAGCCTTGGAGCGCAAAATGTCAGAAATGGAGGAAGAAATGAAGAACCTCCACCAGCTAAAACA
GATTCAAACCTTGAAGCAGATGAACGAGCAACTGCAGGCTGAGAACAGGGCCCTGACCCGAGTGGTGGCC
AGACTCTCGGAGTCCATCGAGTCCTCGGACACCCAGGAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217905 representing NM_032104
Red=Cloning site Green=Tags(s)

MDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESGGSNP
TTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADIKSKL
EKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKNLHQLKQIQTLKQMNEQLQAENRALTRVVA
RLSESIESSDTQEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032104
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032104.3
RefSeq Size 2227 bp
RefSeq ORF 675 bp
Locus ID 4660
UniProt ID O60237
Cytogenetics 1q32.1
Protein Families Druggable Genome
Protein Pathways Vascular smooth muscle contraction
MW 26.1 kDa
Summary Myosin phosphatase is a protein complex comprised of three subunits: a catalytic subunit (PP1c-delta, protein phosphatase 1, catalytic subunit delta), a large regulatory subunit (MYPT, myosin phosphatase target) and small regulatory subunit (sm-M20). Two isoforms of MYPT have been isolated--MYPT1 and MYPT2, the first of which is widely expressed, and the second of which may be specific to heart, skeletal muscle, and brain. Each of the MYPT isoforms functions to bind PP1c-delta and increase phosphatase activity. This locus encodes both MYTP2 and M20. Alternatively spliced transcript variants encoding different isoforms have been identified. Related pseudogenes have been defined on the Y chromosome. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:Myosin Phosphatase 2 (PPP1R12B) (NM_032104) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217905L3 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC217905L4 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4, mGFP tagged 10 ug
$600.00
RG217905 PPP1R12B (tGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC109475 PPP1R12B (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.