SNF5 (SMARCB1) (NM_001007468) Human Tagged ORF Clone

SKU
RC217885
SMARCB1 (Myc-DDK-tagged)-Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SNF5
Synonyms BAF47; CSS3; hSNFS; INI1; MRD15; PPP1R144; RDT; RTPS1; Sfh1p; SNF5; SNF5L1; Snr1; SWNTS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217885 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGATGATGGCGCTGAGCAAGACCTTCGGGCAGAAGCCCGTGAAGTTCCAGCTGGAGGACGACGGCG
AGTTCTACATGATCGGCTCCGAGGTGGGAAACTACCTCCGTATGTTCCGAGGTTCTCTGTACAAGAGATA
CCCCTCACTCTGGAGGCGACTAGCCACTGTGGAAGAGAGGAAGAAAATAGTTGCATCGTCACATGATCAC
GGATACACGACTCTAGCCACCAGTGTGACCCTGTTAAAAGCCTCGGAAGTGGAAGAGATTCTGGATGGCA
ACGATGAGAAGTACAAGGCTGTGTCCATCAGCACAGAGCCCCCCACCTACCTCAGGGAACAGAAGGCCAA
GAGGAACAGCCAGTGGGTACCCACCCTGCCCAACAGCTCCCACCACTTAGATGCCGTGCCATGCTCCACA
ACCATCAACAGGAACCGCATGGGCCGAGACAAGAAGAGAACCTTCCCCCTTTGCTTTGATGACCATGACC
CAGCTGTGATCCATGAGAACGCATCTCAGCCCGAGGTGCTGGTCCCCATCCGGCTGGACATGGAGATCGA
TGGGCAGAAGCTGCGAGACGCCTTCACCTGGAACATGAATGAGAAGTTGATGACGCCTGAGATGTTTTCA
GAAATCCTCTGTGACGATCTGGATTTGAACCCGCTGACGTTTGTGCCAGCCATCGCCTCTGCCATCAGAC
AGCAGATCGAGTCCTACCCCACGGACAGCATCCTGGAGGACCAGTCAGACCAGCGCGTCATCATCAAGCT
GAACATCCATGTGGGAAACATTTCCCTGGTGGACCAGTTTGAGTGGGACATGTCAGAGAAGGAGAACTCA
CCAGAGAAGTTTGCCCTGAAGCTGTGCTCGGAGCTGGGGTTGGGCGGGGAGTTTGTCACCACCATCGCAT
ACAGCATCCGGGGACAGCTGAGCTGGCATCAGAAGACCTACGCCTTCAGCGAGAACCCTCTGCCCACAGT
GGAGATTGCCATCCGGAACACGGGCGATGCGGACCAGTGGTGCCCACTGCTGGAGACTCTGACAGACGCT
GAGATGGAGAAGAAGATCCGCGACCAGGACAGGAACACGAGGCGGATGAGGCGTCTTGCCAACACGGCCC
CGGCCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217885 protein sequence
Red=Cloning site Green=Tags(s)

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDH
GYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCST
TINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFS
EILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS
PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDA
EMEKKIRDQDRNTRRMRRLANTAPAW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001007468
ORF Size 1128 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007468.3
RefSeq Size 1690 bp
RefSeq ORF 1131 bp
Locus ID 6598
UniProt ID Q12824
Cytogenetics 22q11
Protein Families Transcription Factors
MW 43.2 kDa
Summary The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:SNF5 (SMARCB1) (NM_001007468) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217885L1 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC217885L2 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2, mGFP tagged 10 ug
$757.00
RC217885L3 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2, Myc-DDK-tagged 10 ug
$757.00
RC217885L4 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2, mGFP tagged 10 ug
$757.00
RG217885 SMARCB1 (tGFP-tagged) - Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2 10 ug
$657.00
SC301215 SMARCB1 (untagged)-Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.