Syndecan 1 (SDC1) (NM_001006946) Human Tagged ORF Clone

SKU
RC217847
SDC1 (Myc-DDK-tagged)-Human syndecan 1 (SDC1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Syndecan 1
Synonyms CD138; SDC; SYND1; syndecan
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217847 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCGCGCGGCGCTCTGGCTCTGGCTGTGCGCGCTGGCGCTGAGCCTGCAGCCGGCCCTGCCGCAAA
TTGTGGCTACTAATTTGCCCCCTGAAGATCAAGATGGCTCTGGGGATGACTCTGACAACTTCTCCGGCTC
AGGTGCAGGTGCTTTGCAAGATATCACCTTGTCACAGCAGACCCCCTCCACTTGGAAGGACACGCAGCTC
CTGACGGCTATTCCCACGTCTCCAGAACCCACCGGCCTGGAGGCTACAGCTGCCTCCACCTCCACCCTGC
CGGCTGGAGAGGGGCCCAAGGAGGGAGAGGCTGTAGTCCTGCCAGAAGTGGAGCCTGGCCTCACCGCCCG
GGAGCAGGAGGCCACCCCCCGACCCAGGGAGACCACACAGCTCCCGACCACTCATCAGGCCTCAACGACC
ACAGCCACCACGGCCCAGGAGCCCGCCACCTCCCACCCCCACAGGGACATGCAGCCTGGCCACCATGAGA
CCTCAACCCCTGCAGGACCCAGCCAAGCTGACCTTCACACTCCCCACACAGAGGATGGAGGTCCTTCTGC
CACCGAGAGGGCTGCTGAGGATGGAGCCTCCAGTCAGCTCCCAGCAGCAGAGGGCTCTGGGGAGCAGGAC
TTCACCTTTGAAACCTCGGGGGAGAATACGGCTGTAGTGGCCGTGGAGCCTGACCGCCGGAACCAGTCCC
CAGTGGATCAGGGGGCCACGGGGGCCTCACAGGGCCTCCTGGACAGGAAAGAGGTGCTGGGAGGGGTCAT
TGCCGTAGGCCTCGTGGGGCTCATCTTTGCTGTGTGCCTGGTGGGTTTCATGCTGTACCGCATGAAGAAG
AAGGACGAAGGCAGCTACTCCTTGGAGGAGCCGAAACAAGCCAACGGCGGGGCCTACCAGAAGCCCACCA
AACAGGAGGAATTCTATGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217847 protein sequence
Red=Cloning site Green=Tags(s)

MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQL
LTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHQASTT
TATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQD
FTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAVGLVGLIFAVCLVGFMLYRMKK
KDEGSYSLEEPKQANGGAYQKPTKQEEFYA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001006946
ORF Size 930 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001006946.1, NP_001006947.1
RefSeq Size 3309 bp
RefSeq ORF 933 bp
Locus ID 6382
UniProt ID P18827
Cytogenetics 2p24.1
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), ECM-receptor interaction
MW 32.5 kDa
Summary The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-1 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-1 expression has been detected in several different tumor types. While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Syndecan 1 (SDC1) (NM_001006946) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217847L1 Lenti ORF clone of Human syndecan 1 (SDC1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC217847L2 Lenti ORF clone of Human syndecan 1 (SDC1), transcript variant 1, mGFP tagged 10 ug
$750.00
RC217847L3 Lenti ORF clone of Human syndecan 1 (SDC1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC217847L4 Lenti ORF clone of Human syndecan 1 (SDC1), transcript variant 1, mGFP tagged 10 ug
$750.00
RG217847 SDC1 (tGFP-tagged) - Human syndecan 1 (SDC1), transcript variant 1 10 ug
$650.00
SC301129 SDC1 (untagged)-Human syndecan 1 (SDC1), transcript variant 1 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.