SIAT4A (ST3GAL1) (NM_003033) Human Tagged ORF Clone

SKU
RC217696
ST3GAL1 (Myc-DDK-tagged)-Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SIAT4A
Synonyms 1; Gal-NAc6S; SIAT4A; SIATFL; ST3GalA; ST3GalA.1; ST3GalIA; ST3O
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217696 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGACCCTGCGGAAGAGGACCCTGAAAGTGCTCACCTTCCTCGTGCTCTTCATCTTCCTCACCTCCT
TCTTCCTGAACTACTCCCACACCATGGTGGCCACCACCTGGTTCCCCAAGCAGATGGTCCTGGAGCTCTC
CGAGAACCTGAAGAGACTGATCAAGCACAGGCCTTGCACCTGCACCCACTGCATCGGGCAGCGCAAGCTC
TCGGCCTGGTTCGATGAGAGGTTCAACCAGACCATGCAGCCGCTGCTGACTGCCCAGAACGCGCTCTTGG
AGGACGACACCTACCGATGGTGGCTGAGGCTCCAGCGGGAGAAGAAGCCCAATAACTTGAATGACACCAT
CAAGGAGCTGTTCAGAGTGGTGCCTGGGAATGTGGACCCTATGCTGGAGAAGAGGTCGGTGGGCTGCCGG
CGCTGCGCCGTTGTGGGCAACTCGGGCAACCTGAGGGAGTCTTCTTATGGGCCTGAGATAGACAGTCACG
ACTTTGTCCTCAGGATGAACAAGGCGCCCACGGCAGGGTTTGAAGCTGATGTTGGGACCAAGACCACCCA
CCATCTGGTGTACCCTGAGAGCTTCCGGGAGCTGGGAGATAATGTCAGCATGATCCTGGTGCCCTTCAAG
ACCATCGACTTGGAGTGGGTGGTGAGCGCCATCACCACGGGCACCATTTCCCACACCTACATCCCGGTTC
CTGCAAAGATCAGAGTGAAACAGGATAAGATCCTGATCTACCACCCAGCCTTCATCAAGTATGTCTTTGA
CAACTGGCTGCAAGGGCACGGGCGATACCCATCTACCGGCATCCTCTCGGTCATCTTCTCAATGCATGTC
TGCGATGAGGTGGACTTGTACGGCTTCGGGGCAGACAGCAAAGGGAACTGGCACCACTACTGGGAGAACA
ACCCATCCGCGGGGGCTTTTCGCAAGACGGGGGTGCACGATGCAGACTTTGAGTCTAACGTGACGGCCAC
CTTGGCCTCCATCAATAAAATCCGGATCTTCAAGGGGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217696 protein sequence
Red=Cloning site Green=Tags(s)

MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKL
SAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCR
RCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFK
TIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHV
CDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003033
ORF Size 1020 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003033.4
RefSeq Size 6971 bp
RefSeq ORF 1023 bp
Locus ID 6482
UniProt ID Q11201
Cytogenetics 8q24.22
Domains Glyco_transf_29
Protein Families Secreted Protein, Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - ganglio series, Glycosphingolipid biosynthesis - globo series, Keratan sulfate biosynthesis, Metabolic pathways, O-Glycan biosynthesis
MW 39.1 kDa
Summary The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SIAT4A (ST3GAL1) (NM_003033) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217696L1 Lenti ORF clone of Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC217696L2 Lenti ORF clone of Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC217696L3 Lenti ORF clone of Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC217696L4 Lenti ORF clone of Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG217696 ST3GAL1 (tGFP-tagged) - Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC118260 ST3GAL1 (untagged)-Human ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (ST3GAL1), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.