MRP5 (ABCC5) (NM_001023587) Human Tagged ORF Clone

SKU
RC217669
ABCC5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MRP5
Synonyms ABC33; EST277145; MOAT-C; MOATC; MRP5; pABC11; SMRP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217669 representing NM_001023587
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGATATCGACATAGGAAAAGAGTATATCATCCCCAGTCCTGGGTATAGAAGTGTGAGGGAGAGAA
CCAGCACTTCTGGGACGCACAGAGACCGTGAAGATTCCAAGTTCAGGAGAACTCGACCGTTGGAATGCCA
AGATGCCTTGGAAACAGCAGCCCGAGCCGAGGGCCTCTCTCTTGATGCCTCCATGCATTCTCAGCTCAGA
ATCCTGGATGAGGAGCATCCCAAGGGAAAGTACCATCATGGCTTGAGTGCTCTGAAGCCCATCCGGACTA
CTTCCAAACACCAGCACCCAGTGGACAATGCTGGGCTTTTTTCCTGTATGACTTTTTCGTGGCTTTCTTC
TCTGGCCCGTGTGGCCCACAAGAAGGGGGAGCTCTCAATGGAAGACGTGTGGTCTCTGTCCAAGCACGAG
TCTTCTGACGTGAACTGCAGAAGACTAGAGAGACTGTGGCAAGAAGAGCTGAATGAAGTTGGGCCAGACG
CTGCTTCCCTGCGAAGGGTTGTGTGGATCTTCTGCCGCACCAGGCTCATCCTGTCCATCGTGTGCCTGAT
GATCACGCAGCTGGCTGGCTTCAGTGGACCAAATTTTCAGGATGGCTGTATTCTGCGGTCAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217669 representing NM_001023587
Red=Cloning site Green=Tags(s)

MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLR
ILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHE
SSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001023587
ORF Size 624 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001023587.3
RefSeq Size 2007 bp
RefSeq ORF 627 bp
Locus ID 10057
UniProt ID O15440
Cytogenetics 3q27.1
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
MW 23.5 kDa
Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:MRP5 (ABCC5) (NM_001023587) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217669L1 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC217669L2 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2, mGFP tagged 10 ug
$750.00
RC217669L3 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC217669L4 Lenti ORF clone of Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2, mGFP tagged 10 ug
$750.00
RG217669 ABCC5 (tGFP-tagged) - Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2 10 ug
$650.00
SC302224 ABCC5 (untagged)-Human ATP-binding cassette, sub-family C (CFTR/MRP), member 5 (ABCC5), transcript variant 2 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.