CYB5R3 (NM_007326) Human Tagged ORF Clone

SKU
RC217552
CYB5R3 (Myc-DDK-tagged)-Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CYB5R3
Synonyms B5R; DIA1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC217552 representing NM_007326
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTGTTCCAGCGCTCCACGCCAGCCATCACCCTCGAGAGCCCGGACATCAAGTACCCGCTGCGGC
TCATCGACCGGGAGATCATCAGCCATGACACCCGGCGCTTCCGCTTTGCCCTGCCGTCACCCCAGCACAT
CCTGGGCCTCCCTGTCGGCCAGCACATCTACCTCTCGGCTCGAATTGATGGAAACCTGGTCGTCCGGCCC
TATACACCCATCTCCAGCGATGATGACAAGGGCTTCGTGGACCTGGTCATCAAGGTTTACTTCAAGGACA
CCCATCCCAAGTTTCCCGCTGGAGGGAAGATGTCTCAGTACCTGGAGAGCATGCAGATTGGAGACACCAT
TGAGTTCCGGGGCCCCAGTGGGCTGCTGGTCTACCAGGGCAAAGGGAAGTTCGCCATCCGACCTGACAAA
AAGTCCAACCCTATCATCAGGACAGTGAAGTCTGTGGGCATGATCGCGGGAGGGACAGGCATCACCCCGA
TGCTGCAGGTGATCCGCGCCATCATGAAGGACCCTGATGACCACACTGTGTGCCACCTGCTCTTTGCCAA
CCAGACCGAGAAGGACATCCTGCTGCGACCTGAGCTGGAGGAACTCAGGAACAAACATTCTGCACGCTTC
AAGCTCTGGTACACGCTGGACAGAGCCCCTGAAGCCTGGGACTACGGCCAGGGCTTCGTGAATGAGGAGA
TGATCCGGGACCACCTTCCACCCCCAGAGGAGGAGCCGCTGGTGCTGATGTGTGGCCCCCCACCCATGAT
CCAGTACGCCTGCCTTCCCAACCTGGACCACGTGGGCCACCCCACGGAGCGCTGCTTCGTCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC217552 representing NM_007326
Red=Cloning site Green=Tags(s)

MKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRP
YTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDK
KSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARF
KLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007326
ORF Size 834 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007326.4, NP_015565.1
RefSeq Size 2000 bp
RefSeq ORF 837 bp
Locus ID 1727
UniProt ID P00387
Cytogenetics 22q13.2
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism
MW 31.4 kDa
Summary This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010]
Write Your Own Review
You're reviewing:CYB5R3 (NM_007326) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217552L1 Lenti-ORF clone of CYB5R3 (Myc-DDK-tagged)-Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 10 ug
$600.00
RC217552L2 Lenti-ORF clone of CYB5R3 (mGFP-tagged)-Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 10 ug
$600.00
RC217552L3 Lenti-ORF clone of CYB5R3 (Myc-DDK-tagged)-Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 10 ug
$600.00
RC217552L4 Lenti-ORF clone of CYB5R3 (mGFP-tagged)-Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 10 ug
$600.00
RG217552 CYB5R3 (tGFP-tagged) - Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 10 ug
$500.00
SC308951 CYB5R3 (untagged)-Human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.