FEZ2 (NM_001042548) Human Tagged ORF Clone

CAT#: RC217477

FEZ2 (Myc-DDK-tagged)-Human fasciculation and elongation protein zeta 2 (zygin II) (FEZ2), transcript variant 2

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FEZ2 (NM_001042548) Human Tagged ORF Clone
Symbol FEZ2
Synonyms HUM3CL
Vector pCMV6-Entry
Sequence Data
>RC217477 representing NM_001042548
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGACGGGGACTGGCAGGATTTCTATGAGTTCCAGGAGCCGGCCCGGAGCCTCCTGGACCAGG
AGAACTGTAACGCGAGCCCCGAGCCTGGGGCGGAGGCGGGGGCCGAGGCGGGTGGGGGCGCCGACGGTTT
CCCGGCCCCGGCCTGCAGCTTGGAGGAGAAGCTGAGCCTGTGCTTCCGCCCCTCGGATCCGGGCGCCGAG
CCCCCGAGGACGGCCGTGCGGCCCATCACGGAGCGCAGCCTCCTGCAGGGGGACGAGATTTGGAATGCCC
TGACAGATAATTATGGGAATGTGATGCCTGTAGACTGGAAGTCATCGCATACTAGGACCTTGCACTTGCT
TACTCTGAACCTCTCAGAAAAAGGGGTAAGTGACAGTTTGCTCTTTGATACATCAGATGATGAAGAGCTG
AGAGAACAGCTGGATATGCACTCAATCATCGTCTCCTGTGTTAATGATGAACCCCTCTTCACGGCAGACC
AGGTTATTGAAGAAATTGAAGAAATGATGCAGGAATCACCGGACCCAGAAGATGATGAAACCCCTACACA
GTCAGATCGGCTTTCAATGCTTTCCCAGGAAATTCAAACTCTCAAGAGGTCTAGTACCGGCAGTTATGAA
GAGAGAGTGAAAAGGCTCTCAGTGTCTGAGTTAAATGAAATCCTGGAAGAAATTGAGACTGCCATTAAGG
AGTACTCTGAGGAGCTGGTGCAGCAGTTGGCTTTACGAGATGAACTGGAGTTTGAAAAGGAAGTGAAAAA
CAGCTTTATTTCTGTTCTTATTGAAGTGCAAAACAAACAGAAAGAGCACAAAGAAACAGCAAAAAAGAAA
AAGAAACTAAAAAATGGCAGCTCTCAGAATGGGAAGAATGAGAGAAGTCATATGCCCGGCACACGCTTCA
GCATGGAAGGGATCTCAAATGTCATTCAGAATGGCCTCCGCCACACCTTTGGAAATTCAGGTGGAGAGAA
ACAGTATTTGACTACAGTCATTCCTTATGAGAAAAAAAACGGACCACCGTCTGTTGAAGATCTTCAAATA
TTAACAAAAATTCTTCGTGCCATGAAGGAGGACAGTGAAAAAGTTCCGAGCTTGTTAACTGATTATATTC
TGAAAGTTCTGTGTCCTACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217477 representing NM_001042548
Red=Cloning site Green=Tags(s)

MAADGDWQDFYEFQEPARSLLDQENCNASPEPGAEAGAEAGGGADGFPAPACSLEEKLSLCFRPSDPGAE
PPRTAVRPITERSLLQGDEIWNALTDNYGNVMPVDWKSSHTRTLHLLTLNLSEKGVSDSLLFDTSDDEEL
REQLDMHSIIVSCVNDEPLFTADQVIEEIEEMMQESPDPEDDETPTQSDRLSMLSQEIQTLKRSSTGSYE
ERVKRLSVSELNEILEEIETAIKEYSEELVQQLALRDELEFEKEVKNSFISVLIEVQNKQKEHKETAKKK
KKLKNGSSQNGKNERSHMPGTRFSMEGISNVIQNGLRHTFGNSGGEKQYLTTVIPYEKKNGPPSVEDLQI
LTKILRAMKEDSEKVPSLLTDYILKVLCPT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001042548
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001042548.1, NP_001036013
RefSeq Size 2110
RefSeq ORF 1143
Locus ID 9637
Cytogenetics 2p22.2
MW 42.4 kDa
Gene Summary This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Other orthologs include the rat gene that encodes zygin II, which can bind to synaptotagmin. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)